StarFunc result for job id Q9HBU1

User Input

>input (254 residues)
MQRPGEPGAARFGPPEGCADHRPHRYRSFMIEEILTEPPGPKGAAPAAAAAAAGELLKFG
VQALLAARPFHSHLAVLKAEQAAVFKFPLAPLGCSGLSSALLAAGPGLPGAAGAPHLPLE
LQLRGKLEAAGPGEPGTKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLG
LSQLQVKTWYQNRRMKWKKIVLQGGGLESPTKPKGRPKKNSIPTSEQLTEQERAKDAEKP
AEVPGEPSDRSRED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ER42	0.437	0.437	7.146E-36	254	0.957	0.957	Q9ER42.pdb.gz	BARX1_MOUSE Homeobox protein BarH-like 1 OS=Mus musculus OX=10090 GN=Barx1 PE=2 SV=1
2	AFDB:Q503F2	0.545	0.556	1.132E-25	248	0.657	0.673	Q503F2.pdb.gz	BARX1_DANRE Homeobox protein BarH-like 1 OS=Danio rerio OX=7955 GN=barx1 PE=2 SV=2
3	AFDB:Q9UMQ3	0.311	0.287	4.500E-15	279	0.417	0.380	Q9UMQ3.pdb.gz	BARX2_HUMAN Homeobox protein BarH-like 2 OS=Homo sapiens OX=9606 GN=BARX2 PE=1 SV=3
4	AFDB:D3Z4R4	0.217	0.201	6.249E-9	277	0.264	0.242	D3Z4R4.pdb.gz	D3Z4R4_MOUSE NK6 homeobox 2 OS=Mus musculus OX=10090 GN=Nkx6-2 PE=4 SV=1
5	AFDB:Q3C1V8	0.263	0.286	7.613E-9	233	0.303	0.330	Q3C1V8.pdb.gz	BSH_HUMAN Brain-specific homeobox protein homolog OS=Homo sapiens OX=9606 GN=BSX PE=2 SV=2
6	AFDB:A6NJ46	0.240	0.229	8.684E-9	265	0.252	0.242	A6NJ46.pdb.gz	NKX63_HUMAN Homeobox protein Nkx-6.3 OS=Homo sapiens OX=9606 GN=NKX6-3 PE=2 SV=1
7	AFDB:P48031	0.285	0.212	1.207E-8	348	0.248	0.181	P48031.pdb.gz	GBX2_MOUSE Homeobox protein GBX-2 OS=Mus musculus OX=10090 GN=Gbx2 PE=2 SV=1
8	AFDB:Q9YH71	0.252	0.237	1.790E-8	270	0.240	0.226	Q9YH71.pdb.gz	VNT1B_XENLA Homeobox protein vent1B OS=Xenopus laevis OX=8355 GN=vent1B PE=2 SV=1
9	AFDB:B8A5N9	0.234	0.246	1.912E-8	241	0.224	0.237	B8A5N9.pdb.gz
10	AFDB:Q9H4S2	0.246	0.237	3.031E-8	264	0.283	0.273	Q9H4S2.pdb.gz	GSX1_HUMAN GS homeobox 1 OS=Homo sapiens OX=9606 GN=GSX1 PE=1 SV=1
11	PDB:4egcA	0.198	0.094	8.685E-3	539	0.055	0.026	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.203	0.640	2.488E-2	73	0.071	0.247	2hi3A.pdb.gz
13	PDB:2cg4A	0.131	0.212	3.031E-1	149	0.028	0.047	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
14	PDB:7fbyA	0.156	0.239	3.457E-1	153	0.031	0.052	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:5aj0BZ	0.137	0.319	3.943E-1	86	0.039	0.116	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
16	PDB:5z56L	0.173	0.131	4.498E-1	342	0.043	0.032	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
17	PDB:6dv9F	0.119	0.167	1.130	174	0.055	0.080	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
18	PDB:3wqyA	0.133	0.042	1.207	905	0.071	0.020	3wqyA.pdb.gz	The selective tRNA aminoacylation mechanism based on a single G.U pair
19	PDB:2cjjA	0.189	0.648	1.376	63	0.031	0.127	2cjjA.pdb.gz
20	PDB:2h09A	0.103	0.173	1.470	127	0.039	0.079	2h09A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9ER42	1.97e-160	446	254	0.957	0.957	BARX1_MOUSE Homeobox protein BarH-like 1 OS=Mus musculus OX=10090 GN=Barx1 PE=2 SV=1
2	Q503F2	2.50e-112	325	248	0.665	0.681	BARX1_DANRE Homeobox protein BarH-like 1 OS=Danio rerio OX=7955 GN=barx1 PE=2 SV=2
3	Q9UMQ3	1.25e-51	171	279	0.406	0.369	BARX2_HUMAN Homeobox protein BarH-like 2 OS=Homo sapiens OX=9606 GN=BARX2 PE=1 SV=3
4	O08686	1.68e-49	166	283	0.425	0.382	BARX2_MOUSE Homeobox protein BarH-like 2 OS=Mus musculus OX=10090 GN=Barx2 PE=2 SV=2
5	Q22909	7.52e-23	95.5	237	0.177	0.190	HM30_CAEEL Homeobox protein ceh-30 OS=Caenorhabditis elegans OX=6239 GN=ceh-30 PE=2 SV=2
6	Q3C1V8	2.97e-22	93.6	233	0.291	0.318	BSH_HUMAN Brain-specific homeobox protein homolog OS=Homo sapiens OX=9606 GN=BSX PE=2 SV=2
7	Q810B3	4.33e-22	93.2	232	0.280	0.306	BSH_MOUSE Brain-specific homeobox protein homolog OS=Mus musculus OX=10090 GN=Bsx PE=1 SV=1
8	Q04787	1.04e-20	92.4	429	0.213	0.126	BSH_DROME Brain-specific homeobox protein OS=Drosophila melanogaster OX=7227 GN=bsh PE=2 SV=5
9	Q6R3Q6	2.61e-20	88.2	227	0.165	0.185	BSH_DANRE Brain-specific homeobox protein homolog OS=Danio rerio OX=7955 GN=bsx PE=2 SV=1
10	P52950	4.03e-20	89.7	335	0.264	0.200	DBX1_MOUSE Homeobox protein DBX1 OS=Mus musculus OX=10090 GN=Dbx1 PE=2 SV=1
11	Q9NY43	6.81e-20	89.7	387	0.157	0.103	BARH2_HUMAN BarH-like 2 homeobox protein OS=Homo sapiens OX=9606 GN=BARHL2 PE=1 SV=2
12	Q8VIB5	6.92e-20	89.7	384	0.157	0.104	BARH2_MOUSE BarH-like 2 homeobox protein OS=Mus musculus OX=10090 GN=Barhl2 PE=2 SV=2
13	A6NMT0	7.33e-20	89.4	343	0.276	0.204	DBX1_HUMAN Homeobox protein DBX1 OS=Homo sapiens OX=9606 GN=DBX1 PE=3 SV=2
14	O88181	1.06e-19	89.4	384	0.157	0.104	BARH2_RAT BarH-like 2 homeobox protein OS=Rattus norvegicus OX=10116 GN=Barhl2 PE=2 SV=1
15	Q9BZE3	2.63e-19	87.4	327	0.157	0.122	BARH1_HUMAN BarH-like 1 homeobox protein OS=Homo sapiens OX=9606 GN=BARHL1 PE=2 SV=1
16	P63157	3.34e-19	87.0	327	0.157	0.122	BARH1_MOUSE BarH-like 1 homeobox protein OS=Mus musculus OX=10090 GN=Barhl1 PE=2 SV=1
17	Q98875	3.70e-19	85.9	252	0.146	0.147	DLX1A_DANRE Homeobox protein Dlx1a OS=Danio rerio OX=7955 GN=dlx1a PE=2 SV=1
18	Q24256	6.59e-19	87.8	645	0.157	0.062	BARH2_DROME Homeobox protein B-H2 OS=Drosophila melanogaster OX=7227 GN=B-H2 PE=1 SV=3
19	E1BS07	6.66e-19	87.0	403	0.252	0.159	E1BS07_CHICK Leucine twenty homeobox OS=Gallus gallus OX=9031 GN=LEUTX PE=4 SV=3
20	Q64317	1.16e-18	84.3	255	0.157	0.157	DLX1_MOUSE Homeobox protein DLX-1 OS=Mus musculus OX=10090 GN=Dlx1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	1.2e-17	74.8	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000253968

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355245	0.702	Paired box protein Pax-9
2	9606.ENSP00000294638	0.668	LIM/homeobox protein Lhx8
3	9606.ENSP00000362390	0.655	T-box transcription factor TBX22
4	9606.ENSP00000377854	0.652	LIM/homeobox protein Lhx6
5	9606.ENSP00000352565	0.629	Heart- and neural crest derivatives-expressed protein 2
6	9606.ENSP00000245451	0.624	Bone morphogenetic protein 4
7	9606.ENSP00000240055	0.599	Nuclear transcription factor Y subunit beta
8	9606.ENSP00000345001	0.595	CREB-regulated transcription coactivator 1
9	9606.ENSP00000262426	0.581	Forkhead box protein F1
10	9606.ENSP00000264808	0.574	PR domain zinc finger protein 5
11	9606.ENSP00000340896	0.574	Set1/Ash2 histone methyltransferase complex subunit ASH2
12	9606.ENSP00000321797	0.567	Fibroblast growth factor 8
13	9606.ENSP00000414657	0.567	Protein odd-skipped-related 2
14	9606.ENSP00000245479	0.549	Transcription factor SOX-9
15	9606.ENSP00000274063	0.527	Secreted frizzled-related protein 2
16	9606.ENSP00000220772	0.523	Secreted frizzled-related protein 1
17	9606.ENSP00000297261	0.522	Sonic hedgehog protein
18	9606.ENSP00000341957	0.505	Apoptosis-stimulating of p53 protein 2
19	9606.ENSP00000328181	0.501	Noggin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.998	protein binding
GO:0000981	0.986	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.959	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0032502	0.995	developmental process
GO:0048856	0.994	anatomical structure development
GO:0032501	0.992	multicellular organismal process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.965	cellular process
GO:0007275	0.959	multicellular organism development
GO:0019222	0.848	regulation of metabolic process
GO:0060255	0.838	regulation of macromolecule metabolic process
GO:0048518	0.808	positive regulation of biological process
GO:0048731	0.802	system development
GO:0080090	0.797	regulation of primary metabolic process
GO:0051171	0.797	regulation of nitrogen compound metabolic process
GO:0031323	0.796	regulation of cellular metabolic process
GO:0010468	0.796	regulation of gene expression
GO:0048519	0.754	negative regulation of biological process
GO:0048513	0.753	animal organ development
GO:0048522	0.735	positive regulation of cellular process
GO:0048523	0.697	negative regulation of cellular process
GO:0019219	0.647	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.636	regulation of DNA-templated transcription
GO:0050896	0.553	response to stimulus
GO:0009893	0.488	positive regulation of metabolic process
GO:0030154	0.477	cell differentiation
GO:0010604	0.449	positive regulation of macromolecule metabolic process
GO:0009888	0.439	tissue development
GO:0010646	0.428	regulation of cell communication
GO:0023051	0.427	regulation of signaling
GO:0048583	0.419	regulation of response to stimulus
GO:0007154	0.418	cell communication
GO:0051716	0.418	cellular response to stimulus
GO:0023052	0.411	signaling
GO:0006357	0.411	regulation of transcription by RNA polymerase II
GO:0051173	0.409	positive regulation of nitrogen compound metabolic process
GO:0031325	0.400	positive regulation of cellular metabolic process
GO:0009966	0.391	regulation of signal transduction
GO:0009653	0.360	anatomical structure morphogenesis
GO:0007165	0.332	signal transduction
GO:0051254	0.330	positive regulation of RNA metabolic process
GO:0031328	0.327	positive regulation of cellular biosynthetic process
GO:0045893	0.318	positive regulation of DNA-templated transcription
GO:0050793	0.317	regulation of developmental process
GO:0009892	0.315	negative regulation of metabolic process
GO:0042127	0.302	regulation of cell population proliferation
GO:0031324	0.300	negative regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.867	protein-containing complex
GO:0043232	0.327	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]