StarFunc result for job id Q9HBV2

User Input

>input (294 residues)
MSPRGTGCSAGLLMTVGWLLLAGLQSARGTNVTAAVQDAGLAHEGEGEEETENNDSETAE
NYAPPETEDVSNRNVVKEVEFGMCTVTCGIGVREVILTNGCPGGESKCVVRVEECRGPTD
CGWGKPISESLESVRLACIHTSPLNRFKYMWKLLRQDQQSIILVNDSAILEVRKESHPLA
FECDTLDNNEIVATIKFTVYTSSELQMRRSSLPATDAALIFVLTIGVIICVFIIFLLIFI
IINWAAVKAFWGAKASTPEVQSEQSSVRYKDSTSLDQLPTEMPGEDDALSEWNE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HBV2	1.000	1.000	2.922E-48	294	1.000	1.000	Q9HBV2.pdb.gz	SACA1_HUMAN Sperm acrosome membrane-associated protein 1 OS=Homo sapiens OX=9606 GN=SPACA1 PE=1 SV=1
2	AFDB:D5K8A9	0.713	0.711	9.830E-39	295	0.748	0.746	D5K8A9.pdb.gz	SACA1_PIG Sperm acrosome membrane-associated protein 1 OS=Sus scrofa OX=9823 GN=SPACA1 PE=1 SV=1
3	AFDB:Q9DA48	0.673	0.648	1.868E-36	305	0.707	0.682	Q9DA48.pdb.gz	SACA1_MOUSE Sperm acrosome membrane-associated protein 1 OS=Mus musculus OX=10090 GN=Spaca1 PE=1 SV=1
4	AFDB:B6RLL1	0.227	0.217	6.540E-6	311	0.105	0.100	B6RLL1.pdb.gz	B6RLL1_ONCMY Interferon-gamma receptor 2 (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=IFNGR2 PE=2 SV=1
5	AFDB:A8MVW5	0.218	0.147	6.819E-5	462	0.126	0.080	A8MVW5.pdb.gz	HECA2_HUMAN HEPACAM family member 2 OS=Homo sapiens OX=9606 GN=HEPACAM2 PE=1 SV=1
6	AFDB:Q9NQ25	0.232	0.212	2.911E-4	335	0.102	0.090	Q9NQ25.pdb.gz	SLAF7_HUMAN SLAM family member 7 OS=Homo sapiens OX=9606 GN=SLAMF7 PE=1 SV=1
7	AFDB:F1QNH9	0.172	0.093	6.723E-4	712	0.099	0.041	F1QNH9.pdb.gz
8	AFDB:P33896	0.203	0.111	6.723E-4	590	0.088	0.044	P33896.pdb.gz	INAR1_MOUSE Interferon alpha/beta receptor 1 OS=Mus musculus OX=10090 GN=Ifnar1 PE=1 SV=2
9	AFDB:Q6EMK4	0.171	0.086	6.723E-4	673	0.143	0.062	Q6EMK4.pdb.gz	VASN_HUMAN Vasorin OS=Homo sapiens OX=9606 GN=VASN PE=1 SV=1
10	AFDB:B4DW98	0.186	0.212	8.888E-4	241	0.105	0.129	B4DW98.pdb.gz	B4DW98_HUMAN SLAM family member 7 OS=Homo sapiens OX=9606 GN=SLAMF7 PE=1 SV=1
11	PDB:1l9mB	0.184	0.096	3.804E-3	681	0.048	0.021	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.
12	PDB:4gojC	0.155	0.245	1.717E-2	161	0.071	0.130	4gojC.pdb.gz	Structural basis for Arl3-specific release of myristoylated ciliary cargo from UNC119.
13	PDB:4pygA	0.175	0.097	2.270E-2	685	0.051	0.022	4pygA.pdb.gz	Crystal structure of transglutaminase 2 with GTP complex and amino acid sequence evidence of evolution of GTP binding site.
14	PDB:5ir3A	0.187	0.429	2.684E-2	111	0.037	0.099	5ir3A.pdb.gz
15	PDB:8e4cC	0.189	0.339	3.355E-2	142	0.054	0.113	8e4cC.pdb.gz
16	PDB:3s3sA	0.112	0.064	4.689E-2	620	0.044	0.021	3s3sA.pdb.gz	Inhibitors of Transglutaminase 2: A therapeutic option in celiac disease
17	PDB:3besR	0.186	0.213	4.959E-2	250	0.041	0.048	3besR.pdb.gz
18	PDB:7bwaA	0.191	0.094	5.863E-2	674	0.051	0.022	7bwaA.pdb.gz
19	PDB:7u7nC	0.216	0.297	6.931E-2	200	0.071	0.105	7u7nC.pdb.gz
20	PDB:1cd0A	0.192	0.452	8.195E-2	111	0.051	0.135	1cd0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HBV2	0.0	605	294	1.000	1.000	SACA1_HUMAN Sperm acrosome membrane-associated protein 1 OS=Homo sapiens OX=9606 GN=SPACA1 PE=1 SV=1
2	D5K8A9	2.88e-151	427	295	0.752	0.749	SACA1_PIG Sperm acrosome membrane-associated protein 1 OS=Sus scrofa OX=9823 GN=SPACA1 PE=1 SV=1
3	Q9DA48	5.18e-136	388	305	0.714	0.689	SACA1_MOUSE Sperm acrosome membrane-associated protein 1 OS=Mus musculus OX=10090 GN=Spaca1 PE=1 SV=1
4	Q09175	0.020	38.9	709	0.054	0.023	KRP1_SCHPO Dibasic-processing endoprotease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=krp1 PE=1 SV=1
5	F4K6M8	3.4	31.6	540	0.058	0.031	F4K6M8_ARATH Calreticulin family protein OS=Arabidopsis thaliana OX=3702 GN=At5g07340 PE=1 SV=1
6	Q8T3W6	5.3	31.2	406	0.051	0.037	Q8T3W6_DROME AT27166p OS=Drosophila melanogaster OX=7227 GN=hale PE=1 SV=1
7	Q7X8B5	6.0	31.2	1088	0.082	0.022	ACA5_ORYSJ Calcium-transporting ATPase 5, plasma membrane-type OS=Oryza sativa subsp. japonica OX=39947 GN=ACA5 PE=1 SV=2
8	Q8SXR1	6.5	30.4	224	0.071	0.094	Q8SXR1_DROME Neural lazarillo, isoform A OS=Drosophila melanogaster OX=7227 GN=NLaz PE=1 SV=1
9	Q9NAZ4	6.5	30.4	224	0.071	0.094	Q9NAZ4_DROME Neural Lazarillo OS=Drosophila melanogaster OX=7227 GN=NLaz PE=2 SV=1
10	Q6ZFZ4	8.6	30.8	2162	0.105	0.014	DEK1_ORYSJ Calpain-type cysteine protease ADL1 OS=Oryza sativa subsp. japonica OX=39947 GN=ADL1 PE=1 SV=1
11	P29402	9.1	30.4	530	0.044	0.025	CALX1_ARATH Calnexin homolog 1 OS=Arabidopsis thaliana OX=3702 GN=CNX1 PE=1 SV=1
12	Q8RVL1	9.3	30.4	2159	0.105	0.014	DEK1_MAIZE Calpain-type cysteine protease DEK1 OS=Zea mays OX=4577 GN=DEK1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06024 Orf78	2.7e+02	13.3	Orf78 (ac78)
2	PF16101 PRIMA1	90	14.6	Proline-rich membrane anchor 1
3	PF06011 TRP	1.8e+02	12.2	Transient receptor potential (TRP) ion channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000237201

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312774	0.789	Sperm acrosome membrane-associated protein 4
2	9606.ENSP00000432816	0.779	Acrosomal vesicle protein 1
3	9606.ENSP00000315988	0.727	Probable C-mannosyltransferase DPY19L2
4	9606.ENSP00000378851	0.688	MAPK-interacting and spindle-stabilizing protein-like
5	9606.ENSP00000477760	0.684	Anaphase-promoting complex subunit 16
6	9606.ENSP00000046087	0.667	Zona pellucida-binding protein 1
7	9606.ENSP00000229243	0.649	Acrosin-binding protein
8	9606.ENSP00000269053	0.629	Sperm acrosome membrane-associated protein 3
9	9606.ENSP00000318351	0.621	2-oxoisovalerate dehydrogenase subunit beta, mitochondrial
10	9606.ENSP00000341765	0.613	Spermatogenesis-associated protein 16
11	9606.ENSP00000253079	0.610	Coiled-coil domain-containing protein 62
12	9606.ENSP00000262013	0.604	C-Jun-amino-terminal kinase-interacting protein 4
13	9606.ENSP00000312284	0.576	Sperm equatorial segment protein 1
14	9606.ENSP00000327786	0.574	Izumo sperm-egg fusion protein 1
15	9606.ENSP00000335384	0.557	Zona pellucida-binding protein 2
16	9606.ENSP00000291823	0.541	Homeodomain-interacting protein kinase 4
17	9606.ENSP00000345849	0.541	Hyaluronidase PH-20
18	9606.ENSP00000359171	0.530	Hippocampus abundant transcript 1
19	9606.ENSP00000297767	0.520	Probable inactive serine protease 37
20	9606.ENSP00000296513	0.519	Adenosine deaminase domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0007283	0.988	spermatogenesis
GO:0022412	0.986	cellular process involved in reproduction in multicellular organism
GO:0007286	0.983	spermatid development
GO:0010256	0.971	endomembrane system organization
GO:0032989	0.948	cellular component morphogenesis
GO:0016050	0.940	vesicle organization
GO:0033363	0.934	secretory granule organization
GO:0048646	0.933	anatomical structure formation involved in morphogenesis
GO:0022607	0.856	cellular component assembly
GO:0010927	0.850	cellular component assembly involved in morphogenesis
GO:0070925	0.428	organelle assembly
GO:0065007	0.353	biological regulation
GO:0050789	0.309	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0002080	1.000	acrosomal membrane
GO:0005634	0.501	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]