StarFunc result for job id Q9HBW0

User Input

>input (351 residues)
MVIMGQCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASN
RRFHQPIYYLLGNLAAADLFAGVAYLFLMFHTGPRTARLSLEGWFLRQGLLDTSLTASVA
TLLAIAVERHRSVMAVQLHSRLPRGRVVMLIVGVWVAALGLGLLPAHSWHCLCALDRCSR
MAPLLSRSYLAVWALSSLLVFLLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRETTLSLV
KTVVIILGAFVVCWTPGQVVLLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDA
EMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HBW0	1.000	1.000	3.452E-47	351	1.000	1.000	Q9HBW0.pdb.gz	LPAR2_HUMAN Lysophosphatidic acid receptor 2 OS=Homo sapiens OX=9606 GN=LPAR2 PE=1 SV=3
2	AFDB:F1Q734	0.866	0.824	1.780E-30	369	0.547	0.520	F1Q734.pdb.gz
3	AFDB:F1QFF1	0.880	0.868	5.305E-30	356	0.507	0.500	F1QFF1.pdb.gz	F1QFF1_DANRE Lysophosphatidic acid receptor 2 isoform X1 OS=Danio rerio OX=7955 GN=zgc:101053 PE=3 SV=1
4	AFDB:Q7ZZ93	0.868	0.881	9.360E-30	346	0.527	0.535	Q7ZZ93.pdb.gz
5	AFDB:P61793	0.866	0.836	3.322E-29	364	0.527	0.508	P61793.pdb.gz	LPAR1_MOUSE Lysophosphatidic acid receptor 1 OS=Mus musculus OX=10090 GN=Lpar1 PE=1 SV=1
6	AFDB:A0A0R4IAQ2	0.870	0.865	8.158E-27	353	0.427	0.425	A0A0R4IAQ2.pdb.gz
7	AFDB:Q8K5E0	0.853	0.846	1.028E-25	354	0.459	0.455	Q8K5E0.pdb.gz	LPAR3_RAT Lysophosphatidic acid receptor 3 OS=Rattus norvegicus OX=10116 GN=Lpar3 PE=2 SV=1
8	PDB:7td1R	0.777	0.924	3.345E-23	293	0.476	0.570	7td1R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
9	PDB:7yu4A	0.713	0.933	1.151E-21	266	0.444	0.586	7yu4A.pdb.gz	Structure of the active G i -coupled human lysophosphatidic acid receptor 1 complexed with a potent agonist.
10	AFDB:Q9DDK4	0.800	0.777	1.015E-19	362	0.333	0.323	Q9DDK4.pdb.gz	S1PR1_DANRE Sphingosine 1-phosphate receptor 1 OS=Danio rerio OX=7955 GN=s1pr1 PE=2 SV=2
11	AFDB:P48303	0.798	0.734	2.227E-19	383	0.350	0.321	P48303.pdb.gz	S1PR1_RAT Sphingosine 1-phosphate receptor 1 OS=Rattus norvegicus OX=10116 GN=S1pr1 PE=1 SV=1
12	AFDB:A0A0R4IY24	0.681	0.840	1.027E-18	280	0.407	0.511	A0A0R4IY24.pdb.gz
13	PDB:7td3R	0.734	0.871	5.339E-17	292	0.322	0.387	7td3R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
14	PDB:7ew2R	0.717	0.855	6.048E-14	290	0.293	0.355	7ew2R.pdb.gz	Structural insights into sphingosine-1-phosphate recognition and ligand selectivity of S1PR3-Gi signaling complexes.
15	PDB:3v2yA	0.714	0.556	1.387E-13	455	0.308	0.237	3v2yA.pdb.gz	Crystal structure of a lipid G protein-coupled receptor.
16	PDB:7t6bR	0.677	0.885	4.372E-12	264	0.293	0.390	7t6bR.pdb.gz	Structure of S1PR2-heterotrimeric G 13 signaling complex.
17	PDB:7wv9R	0.686	0.817	2.509E-11	290	0.217	0.262	7wv9R.pdb.gz	Molecular mechanism of allosteric modulation for the cannabinoid receptor CB1.
18	PDB:6pt0R	0.716	0.835	8.523E-11	298	0.199	0.235	6pt0R.pdb.gz	Cryo-EM Structure of the Human Cannabinoid Receptor CB2-GiSignaling Complex.
19	PDB:7f53R	0.629	0.794	2.133E-10	273	0.208	0.267	7f53R.pdb.gz	Structural insights into ligand recognition and activation of the melanocortin-4 receptor.
20	PDB:7e32R	0.618	0.748	5.825E-10	285	0.191	0.235	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HBW0	0.0	704	348	0.991	1.000	LPAR2_HUMAN Lysophosphatidic acid receptor 2 OS=Homo sapiens OX=9606 GN=LPAR2 PE=1 SV=3
2	Q9JL06	0.0	628	348	0.915	0.922	LPAR2_MOUSE Lysophosphatidic acid receptor 2 OS=Mus musculus OX=10090 GN=Lpar2 PE=2 SV=2
3	Q6DHQ8	6.44e-128	372	346	0.524	0.532	Q6DHQ8_DANRE Lysophosphatidic acid receptor 1 OS=Danio rerio OX=7955 GN=edg2 PE=2 SV=1
4	Q6DC27	2.04e-124	363	356	0.490	0.483	Q6DC27_DANRE Lysophosphatidic acid receptor 2 OS=Danio rerio OX=7955 GN=zgc:101053 PE=2 SV=1
5	F1QFF1	2.23e-124	363	356	0.490	0.483	F1QFF1_DANRE Lysophosphatidic acid receptor 2 isoform X1 OS=Danio rerio OX=7955 GN=zgc:101053 PE=3 SV=1
6	P61793	4.17e-123	360	364	0.510	0.492	LPAR1_MOUSE Lysophosphatidic acid receptor 1 OS=Mus musculus OX=10090 GN=Lpar1 PE=1 SV=1
7	P61794	4.17e-123	360	364	0.510	0.492	LPAR1_RAT Lysophosphatidic acid receptor 1 OS=Rattus norvegicus OX=10116 GN=Lpar1 PE=1 SV=1
8	Q92633	1.92e-122	358	364	0.513	0.495	LPAR1_HUMAN Lysophosphatidic acid receptor 1 OS=Homo sapiens OX=9606 GN=LPAR1 PE=1 SV=3
9	Q9EQ31	6.44e-110	326	354	0.467	0.463	LPAR3_MOUSE Lysophosphatidic acid receptor 3 OS=Mus musculus OX=10090 GN=Lpar3 PE=1 SV=1
10	Q8K5E0	5.70e-108	321	354	0.453	0.449	LPAR3_RAT Lysophosphatidic acid receptor 3 OS=Rattus norvegicus OX=10116 GN=Lpar3 PE=2 SV=1
11	Q9UBY5	1.18e-105	315	353	0.456	0.453	LPAR3_HUMAN Lysophosphatidic acid receptor 3 OS=Homo sapiens OX=9606 GN=LPAR3 PE=1 SV=1
12	K9M3I1	4.21e-91	278	353	0.444	0.442	K9M3I1_DANRE Lysophosphatidic acid receptor 1 OS=Danio rerio OX=7955 GN=Lpar3 PE=2 SV=1
13	P21453	4.90e-63	207	382	0.325	0.298	S1PR1_HUMAN Sphingosine 1-phosphate receptor 1 OS=Homo sapiens OX=9606 GN=S1PR1 PE=1 SV=2
14	P48303	1.12e-62	206	383	0.311	0.285	S1PR1_RAT Sphingosine 1-phosphate receptor 1 OS=Rattus norvegicus OX=10116 GN=S1pr1 PE=1 SV=1
15	O08530	4.30e-62	204	382	0.308	0.283	S1PR1_MOUSE Sphingosine 1-phosphate receptor 1 OS=Mus musculus OX=10090 GN=S1pr1 PE=1 SV=3
16	Q9DDK4	4.45e-61	201	362	0.330	0.320	S1PR1_DANRE Sphingosine 1-phosphate receptor 1 OS=Danio rerio OX=7955 GN=s1pr1 PE=2 SV=2
17	Q99500	7.11e-56	188	378	0.311	0.288	S1PR3_HUMAN Sphingosine 1-phosphate receptor 3 OS=Homo sapiens OX=9606 GN=S1PR3 PE=1 SV=2
18	Q9Z0U9	2.04e-55	187	378	0.311	0.288	S1PR3_MOUSE Sphingosine 1-phosphate receptor 3 OS=Mus musculus OX=10090 GN=S1pr3 PE=2 SV=1
19	Q9I8K8	2.66e-55	187	370	0.308	0.292	S1PR2_DANRE Sphingosine 1-phosphate receptor 2 OS=Danio rerio OX=7955 GN=s1pr2 PE=1 SV=1
20	P47752	6.37e-55	185	352	0.328	0.327	S1PR2_RAT Sphingosine 1-phosphate receptor 2 OS=Rattus norvegicus OX=10116 GN=S1pr2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	6.4e-30	115.9	7 transmembrane receptor (rhodopsin family)
2	PF13853 7tm_4	0.3	22.4	Olfactory receptor
3	PF10320 7TM_GPCR_Srsx	1e-05	36.7	Serpentine type 7TM GPCR chemoreceptor Srsx
4	PF10321 7TM_GPCR_Srt	5.5e+02	10.9	Serpentine type 7TM GPCR chemoreceptor Srt
5	PF15872 SRTM1	6.3e+02	11.9	Serine-rich and transmembrane domain-containing protein 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000443256

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000200457	0.999	Thyroid receptor-interacting protein 6
2	9606.ENSP00000408005	0.999	Na(+)/H(+) exchange regulatory cofactor NHE-RF2
3	9606.ENSP00000408205	0.978	Lysophosphatidic acid receptor 4
4	9606.ENSP00000327875	0.977	Lysophosphatidic acid receptor 5
5	9606.ENSP00000286548	0.967	Guanine nucleotide-binding protein G(q) subunit alpha
6	9606.ENSP00000367691	0.953	Lysophosphatidic acid receptor 6
7	9606.ENSP00000275364	0.951	Guanine nucleotide-binding protein subunit alpha-12
8	9606.ENSP00000329213	0.948	Apoptosis regulatory protein Siva
9	9606.ENSP00000443631	0.948	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
10	9606.ENSP00000400175	0.944	Transforming protein RhoA
11	9606.ENSP00000262958	0.943	Guanine nucleotide-binding protein subunit alpha-15
12	9606.ENSP00000306512	0.929	Interleukin-8
13	9606.ENSP00000263088	0.921	Phospholipase D2
14	9606.ENSP00000365807	0.920	Guanine nucleotide-binding protein subunit alpha-14
15	9606.ENSP00000275493	0.917	Epidermal growth factor receptor
16	9606.ENSP00000360266	0.914	Transcription factor AP-1
17	9606.ENSP00000078429	0.913	Guanine nucleotide-binding protein subunit alpha-11
18	9606.ENSP00000306245	0.911	Proto-oncogene c-Fos
19	9606.ENSP00000380638	0.911	Protein-tyrosine kinase 2-beta
20	9606.ENSP00000289153	0.906	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004930	1.000	G protein-coupled receptor activity
GO:0005515	0.995	protein binding
GO:0008289	0.994	lipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.997	signal transduction
GO:0007186	0.989	G protein-coupled receptor signaling pathway
GO:0048518	0.791	positive regulation of biological process
GO:0065009	0.668	regulation of molecular function
GO:0048522	0.627	positive regulation of cellular process
GO:0048583	0.543	regulation of response to stimulus
GO:0023051	0.537	regulation of signaling
GO:0010646	0.537	regulation of cell communication
GO:0009966	0.527	regulation of signal transduction
GO:0050790	0.426	regulation of catalytic activity
GO:0044093	0.362	positive regulation of molecular function
GO:0051336	0.345	regulation of hydrolase activity
GO:0065008	0.336	regulation of biological quality
GO:0048584	0.329	positive regulation of response to stimulus
GO:1902531	0.323	regulation of intracellular signal transduction
GO:0043085	0.317	positive regulation of catalytic activity
GO:0023056	0.316	positive regulation of signaling
GO:0010647	0.316	positive regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.961	intracellular anatomical structure
GO:0043226	0.949	organelle
GO:0043227	0.914	membrane-bounded organelle
GO:0005737	0.884	cytoplasm
GO:0043229	0.787	intracellular organelle
GO:0043231	0.755	intracellular membrane-bounded organelle
GO:0031982	0.618	vesicle
GO:0012505	0.423	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]