StarFunc result for job id Q9HBX8

User Input

>input (967 residues)
MPSPPGLRALWLCAALCASRRAGGAPQPGPGPTACPAPCHCQEDGIMLSADCSELGLSAV
PGDLDPLTAYLDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSGLYSLKILM
LQNNQLGGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVR
ALNNLPALQAMTLALNRISHIPDYAFQNLTSLVVLHLHNNRIQHLGTHSFEGLHNLETLD
LNYNKLQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFMGNPLLQTIHFYDNPIQFVGRSA
FQYLPKLHTLSLNGAMDIQEFPDLKGTTSLEILTLTRAGIRLLPSGMCQQLPRLRVLELS
HNQIEELPSLHRCQKLEEIGLQHNRIWEIGADTFSQLSSLQALDLSWNAIRSIHPEAFST
LHSLVKLDLTDNQLTTLPLAGLGGLMHLKLKGNLALSQAFSKDSFPKLRILEVPYAYQCC
PYGMCASFFKASGQWEAEDLHLDDEESSKRPLGLLARQAENHYDQDLDELQLEMEDSKPH
PSVQCSPTPGPFKPCEYLFESWGIRLAVWAIVLLSVLCNGLVLLTVFAGGPVPLPPVKFV
VGAIAGANTLTGISCGLLASVDALTFGQFSEYGARWETGLGCRATGFLAVLGSEASVLLL
TLAAVQCSVSVSCVRAYGKSPSLGSVRAGVLGCLALAGLAAALPLASVGEYGASPLCLPY
APPEGQPAALGFTVALVMMNSFCFLVVAGAYIKLYCDLPRGDFEAVWDCAMVRHVAWLIF
ADGLLYCPVAFLSFASMLGLFPVTPEAVKSVLLVVLPLPACLNPLLYLLFNPHFRDDLRR
LRPRAGDSGPLAYAAAGELEKSSCDSTQALVAFSDVDLILEASEAGRPPGLETYGFPSVT
LISCQQPGAPRLEGSHCVEPEGNHFGNPQPSMDGELLLRAEGSTPAGGGLSGGGGFQPSG
LAFASHV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UVD5	0.877	0.877	0.000	967	0.901	0.901	Q3UVD5.pdb.gz	LGR6_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Mus musculus OX=10090 GN=Lgr6 PE=2 SV=1
2	AFDB:E7FE13	0.759	0.756	1.350E-89	971	0.442	0.440	E7FE13.pdb.gz	LGR4_DANRE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Danio rerio OX=7955 GN=lgr4 PE=2 SV=1
3	AFDB:B0BLW3	0.788	0.798	2.350E-89	955	0.443	0.448	B0BLW3.pdb.gz	LGR4_XENTR Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Xenopus tropicalis OX=8364 GN=lgr4 PE=1 SV=1
4	AFDB:Q7KTA0	0.591	0.443	5.962E-60	1360	0.303	0.215	Q7KTA0.pdb.gz	Q7KTA0_DROME Rickets OS=Drosophila melanogaster OX=7227 GN=rk PE=3 SV=1
5	AFDB:P21463	0.374	0.468	9.617E-34	764	0.170	0.215	P21463.pdb.gz	TSHR_RAT Thyrotropin receptor OS=Rattus norvegicus OX=10116 GN=Tshr PE=1 SV=2
6	AFDB:Q6R6I6	0.302	0.375	3.391E-33	758	0.165	0.211	Q6R6I6.pdb.gz	RXFP1_RAT Relaxin receptor 1 OS=Rattus norvegicus OX=10116 GN=Rxfp1 PE=2 SV=1
7	AFDB:P16473	0.363	0.454	9.295E-33	764	0.180	0.228	P16473.pdb.gz	TSHR_HUMAN Thyrotropin receptor OS=Homo sapiens OX=9606 GN=TSHR PE=1 SV=2
8	AFDB:Q9HBX9	0.306	0.377	1.539E-32	757	0.169	0.215	Q9HBX9.pdb.gz	RXFP1_HUMAN Relaxin receptor 1 OS=Homo sapiens OX=9606 GN=RXFP1 PE=1 SV=2
9	AFDB:Q6QMG1	0.347	0.425	1.702E-32	778	0.173	0.215	Q6QMG1.pdb.gz	TSHR_ICTPU Thyrotropin receptor OS=Ictalurus punctatus OX=7998 GN=tshr PE=1 SV=1
10	AFDB:F1RSS8	0.290	0.386	1.883E-32	711	0.174	0.236	F1RSS8.pdb.gz	F1RSS8_PIG Relaxin family peptide receptor 2 OS=Sus scrofa OX=9823 GN=RXFP2 PE=4 SV=3
11	PDB:7xw5R	0.337	0.543	6.857E-29	572	0.148	0.250	7xw5R.pdb.gz	Hormone- and antibody-mediated activation of the thyrotropin receptor.
12	PDB:7fiiR	0.370	0.575	2.416E-25	570	0.146	0.247	7fiiR.pdb.gz
13	PDB:7tvfD	0.325	0.548	1.455E-16	515	0.127	0.239	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
14	PDB:6gffI	0.328	0.537	1.209E-15	551	0.140	0.245	6gffI.pdb.gz
15	PDB:7wv3A	0.258	0.358	7.422E-15	668	0.118	0.171	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
16	PDB:3t6qA	0.223	0.332	2.617E-14	601	0.111	0.178	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
17	PDB:3b2dA	0.210	0.299	5.575E-14	601	0.112	0.180	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
18	PDB:7wrqA	0.313	0.478	4.049E-12	566	0.143	0.244	7wrqA.pdb.gz
19	PDB:1xcdA	0.258	0.779	7.414E-12	305	0.092	0.292	1xcdA.pdb.gz
20	PDB:3j0aA	0.250	0.291	7.166E-11	797	0.114	0.138	3j0aA.pdb.gz	Toll-like receptor 5 forms asymmetric dimers in the absence of flagellin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A8K8C7	0.0	957	907	0.513	0.547	A0A0A8K8C7_HUMAN G protein-coupled receptor 49 OS=Homo sapiens OX=9606 GN=GPR49 PE=2 SV=1
2	A2ARI4	0.0	775	951	0.450	0.457	LGR4_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Mus musculus OX=10090 GN=Lgr4 PE=1 SV=1
3	B0BLW3	0.0	755	955	0.420	0.425	LGR4_XENTR Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Xenopus tropicalis OX=8364 GN=lgr4 PE=1 SV=1
4	E7FE13	0.0	710	971	0.416	0.414	LGR4_DANRE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Danio rerio OX=7955 GN=lgr4 PE=2 SV=1
5	O75473	0.0	957	907	0.513	0.547	LGR5_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Homo sapiens OX=9606 GN=LGR5 PE=1 SV=1
6	Q3UVD5	0.0	1711	967	0.902	0.902	LGR6_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Mus musculus OX=10090 GN=Lgr6 PE=2 SV=1
7	Q9BXB1	0.0	783	951	0.426	0.433	LGR4_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Homo sapiens OX=9606 GN=LGR4 PE=1 SV=2
8	Q9HBX8	0.0	1952	967	1.000	1.000	LGR6_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Homo sapiens OX=9606 GN=LGR6 PE=1 SV=3
9	Q9Z1P4	0.0	942	907	0.505	0.538	LGR5_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Mus musculus OX=10090 GN=Lgr5 PE=1 SV=2
10	Q7KTA0	2.14e-73	267	1360	0.254	0.181	Q7KTA0_DROME Rickets OS=Drosophila melanogaster OX=7227 GN=rk PE=3 SV=1
11	Q9NDI1	1.22e-72	265	1360	0.253	0.180	Q9NDI1_DROME Glycoprotein hormone receptor II OS=Drosophila melanogaster OX=7227 GN=rk PE=2 SV=1
12	Q9BN18	6.52e-70	254	1050	0.228	0.210	Q9BN18_DROME Leucine-rich repeat-containing G protein-coupled receptor 2 OS=Drosophila melanogaster OX=7227 GN=rk PE=2 SV=1
13	P35379	6.75e-51	193	695	0.171	0.237	FSHR_SHEEP Follicle-stimulating hormone receptor OS=Ovis aries OX=9940 GN=FSHR PE=1 SV=1
14	P20395	8.83e-48	184	692	0.175	0.244	FSHR_RAT Follicle-stimulating hormone receptor OS=Rattus norvegicus OX=10116 GN=Fshr PE=1 SV=1
15	P23945	4.19e-47	182	695	0.164	0.229	FSHR_HUMAN Follicle-stimulating hormone receptor OS=Homo sapiens OX=9606 GN=FSHR PE=1 SV=3
16	P35378	3.49e-46	179	692	0.173	0.241	FSHR_MOUSE Follicle-stimulating hormone receptor OS=Mus musculus OX=10090 GN=Fshr PE=2 SV=2
17	Q7T027	4.46e-44	173	728	0.178	0.236	Q7T027_SALSA Lutropin-choriogonadotropic hormone receptor OS=Salmo salar OX=8030 GN=lh-R PE=2 SV=1
18	Q6TCF8	4.22e-43	170	708	0.169	0.230	Q6TCF8_DANRE Lutropin-choriogonadotropic hormone receptor OS=Danio rerio OX=7955 GN=LHR PE=2 SV=1
19	Q71MM9	9.63e-43	169	727	0.176	0.234	Q71MM9_ONCMY Lutropin-choriogonadotropic hormone receptor OS=Oncorhynchus mykiss OX=8022 GN=LHCGR PE=2 SV=1
20	Q7T2G8	7.75e-42	166	658	0.162	0.239	Q7T2G8_SALSA Thyrotropin receptor OS=Salmo salar OX=8030 GN=fsh-R PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	38	15.0	7 transmembrane receptor (rhodopsin family)
2	PF01462 LRRNT	0.07	24.1	Leucine rich repeat N-terminal domain
3	PF00560 LRR_1	5.7e-09	46.0	Leucine Rich Repeat
4	PF12799 LRR_4	2.2e-33	124.8	Leucine Rich repeats (2 copies)
5	PF13306 LRR_5	4.9e-31	118.8	BspA type Leucine rich repeat region (6 copies)
6	PF13516 LRR_6	0.023	25.8	Leucine Rich repeat
7	PF13855 LRR_8	3.3e-71	246.2	Leucine rich repeat
8	PF14580 LRR_9	3e-11	54.7	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356247

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348944	0.986	R-spondin-1
2	9606.ENSP00000368516	0.913	Leucine-rich repeat-containing G-protein coupled receptor 4
3	9606.ENSP00000441543	0.912	Polyubiquitin-C
4	9606.ENSP00000266674	0.910	Leucine-rich repeat-containing G-protein coupled receptor 5
5	9606.ENSP00000304697	0.910	Polyubiquitin-B
6	9606.ENSP00000272317	0.906	Ubiquitin-40S ribosomal protein S27a
7	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
8	9606.ENSP00000276659	0.889	R-spondin-2
9	9606.ENSP00000217260	0.882	R-spondin-4
10	9606.ENSP00000443824	0.850	E3 ubiquitin-protein ligase ZNRF3
11	9606.ENSP00000349131	0.829	R-spondin-3
12	9606.ENSP00000463069	0.824	E3 ubiquitin-protein ligase RNF43
13	9606.ENSP00000223862	0.720	Prorelaxin H1
14	9606.ENSP00000254043	0.619	Keratin, type I cytoskeletal 15
15	9606.ENSP00000341412	0.618	Placenta-expressed transcript 1 protein
16	9606.ENSP00000344456	0.610	Catenin beta-1
17	9606.ENSP00000335158	0.606	Probable G-protein coupled receptor 142
18	9606.ENSP00000367301	0.575	Norrin
19	9606.ENSP00000343126	0.572	AT-rich interactive domain-containing protein 3B
20	9606.ENSP00000261349	0.569	Low-density lipoprotein receptor-related protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004888	0.887	transmembrane signaling receptor activity
GO:0004930	0.861	G protein-coupled receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0048856	0.987	anatomical structure development
GO:0048518	0.979	positive regulation of biological process
GO:0048522	0.957	positive regulation of cellular process
GO:0030111	0.952	regulation of Wnt signaling pathway
GO:0009987	0.949	cellular process
GO:0023056	0.813	positive regulation of signaling
GO:0010647	0.812	positive regulation of cell communication
GO:0048584	0.784	positive regulation of response to stimulus
GO:0009967	0.711	positive regulation of signal transduction
GO:0030177	0.591	positive regulation of Wnt signaling pathway
GO:0032501	0.538	multicellular organismal process
GO:0040012	0.511	regulation of locomotion
GO:0007275	0.425	multicellular organism development
GO:0050896	0.411	response to stimulus
GO:0048519	0.346	negative regulation of biological process
GO:0048523	0.344	negative regulation of cellular process
GO:0051716	0.331	cellular response to stimulus
GO:0060828	0.331	regulation of canonical Wnt signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.996	membrane-bounded organelle
GO:0031982	0.914	vesicle
GO:0005576	0.881	extracellular region
GO:0005622	0.878	intracellular anatomical structure
GO:0043231	0.866	intracellular membrane-bounded organelle
GO:0005737	0.490	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]