StarFunc result for job id Q9HBZ2

User Input

>input (717 residues)
MATPAAVNPPEMASDIPGSVTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGP
SKFSRENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTG
NKSTDGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFG
STLYEQVHPDDVEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICR
MRCGNAPLDHLPLNRITTMRKRFRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMTIPEED
ADVGQGSKYCLVAIGRLQVTSSPVCMDMNGMSVPTEFLSRHNSDGIITFVDPRCISVIGY
QPQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTF
QNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSV
EKADAIFSQERDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSS
VVHVPGVNDIQSSSSTGQNMSQISRQLNQSQVAWTGSRPPFPGQQIPSQSSKTQSSPFGI
GTSHTYPADPSSYSPLSSPATSSPSGNAYSSLANRTPGFAESGQSSGQFQGRPSEVWSQW
QSQHHGQQSGEQHSHQQPGQTEVFQDMLPMPGDPTQGTGNYNIEDFADLGMFPPFSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HBZ2	0.999	0.999	0.000	717	1.000	1.000	Q9HBZ2.pdb.gz	ARNT2_HUMAN Aryl hydrocarbon receptor nuclear translocator 2 OS=Homo sapiens OX=9606 GN=ARNT2 PE=1 SV=2
2	AFDB:P79832	0.548	0.543	4.817E-70	723	0.547	0.542	P79832.pdb.gz	ARNT_ONCMY Aryl hydrocarbon receptor nuclear translocator OS=Oncorhynchus mykiss OX=8022 GN=arnt PE=1 SV=1
3	AFDB:E7FDK6	0.527	0.518	4.414E-66	731	0.508	0.498	E7FDK6.pdb.gz
4	AFDB:O15945	0.514	0.571	1.420E-54	642	0.393	0.439	O15945.pdb.gz	ARNT_DROME Aryl hydrocarbon receptor nuclear translocator homolog OS=Drosophila melanogaster OX=7227 GN=tgo PE=1 SV=3
5	AFDB:F8W2W5	0.196	0.176	4.063E-27	810	0.206	0.183	F8W2W5.pdb.gz	F8W2W5_DANRE Endothelial PAS domain protein 1a OS=Danio rerio OX=7955 GN=epas1a PE=4 SV=1
6	AFDB:F8VR32	0.150	0.122	1.650E-23	938	0.197	0.150	F8VR32.pdb.gz	F8VR32_HUMAN Neuronal PAS domain protein 3 OS=Homo sapiens OX=9606 GN=NPAS3 PE=1 SV=1
7	AFDB:Q9VBH3	0.153	0.123	2.390E-22	920	0.149	0.116	Q9VBH3.pdb.gz	Q9VBH3_DROME Dysfusion, isoform D OS=Drosophila melanogaster OX=7227 GN=dysf PE=4 SV=4
8	AFDB:Q3U1U7	0.181	0.185	3.885E-13	701	0.174	0.178	Q3U1U7.pdb.gz	AHRR_MOUSE Aryl hydrocarbon receptor repressor OS=Mus musculus OX=10090 GN=Ahrr PE=1 SV=1
9	AFDB:E5L8C8	0.187	0.179	1.172E-12	756	0.163	0.155	E5L8C8.pdb.gz	E5L8C8_CHICK Aryl hydrocarbon receptor repressor OS=Gallus gallus OX=9031 GN=ahrr PE=2 SV=1
10	AFDB:Q8CEE6	0.131	0.077	4.830E-11	1383	0.148	0.077	Q8CEE6.pdb.gz	PASK_MOUSE PAS domain-containing serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Pask PE=1 SV=3
11	PDB:6umzA	0.124	0.608	4.011E-5	127	0.021	0.118	6umzA.pdb.gz	Structural and spectroscopic characterization of photoactive yellow protein and photoswitchable fluorescent protein constructs containing heavy atoms.
12	PDB:7rzwB	0.147	0.123	1.016E-4	864	0.042	0.035	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
13	PDB:2wkpA	0.136	0.288	3.065E-4	320	0.021	0.047	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
14	PDB:6jp8F	0.103	0.078	3.443E-4	973	0.024	0.017	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
15	PDB:6jt0B	0.098	0.116	1.339E-2	576	0.022	0.028	6jt0B.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
16	PDB:6nzdH	0.084	0.135	8.112E-2	387	0.020	0.036	6nzdH.pdb.gz	Structural mechanism of a Rag GTPase activation checkpoint by the lysosomal folliculin complex.
17	PDB:7bwnJ	0.055	0.104	1.085E-1	280	0.021	0.054	7bwnJ.pdb.gz	Cellular Synthesis and X-ray Crystal Structure of a Designed Protein Heterocatenane.
18	PDB:6dhdA	0.035	0.050	1.218E-1	501	0.013	0.018	6dhdA.pdb.gz	Structures of bovine glutamate dehydrogenase complexes elucidate the mechanism of purine regulation.
19	PDB:7cpxA	0.049	0.022	1.727E-1	2262	0.029	0.009	7cpxA.pdb.gz	Structural basis for the biosynthesis of lovastatin.
20	PDB:6mdra	0.040	0.086	2.178E-1	231	0.029	0.091	6mdra.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P27540	0.0	857	789	0.651	0.592	ARNT_HUMAN Aryl hydrocarbon receptor nuclear translocator OS=Homo sapiens OX=9606 GN=ARNT PE=1 SV=1
2	P41739	0.0	853	800	0.646	0.579	ARNT_RAT Aryl hydrocarbon receptor nuclear translocator OS=Rattus norvegicus OX=10116 GN=Arnt PE=1 SV=2
3	P53762	0.0	864	791	0.643	0.583	ARNT_MOUSE Aryl hydrocarbon receptor nuclear translocator OS=Mus musculus OX=10090 GN=Arnt PE=1 SV=3
4	P79832	0.0	705	723	0.537	0.533	ARNT_ONCMY Aryl hydrocarbon receptor nuclear translocator OS=Oncorhynchus mykiss OX=8022 GN=arnt PE=1 SV=1
5	Q1JPT1	0.0	618	440	0.406	0.661	Q1JPT1_DANRE Aryl hydrocarbon receptor nuclear translocator OS=Danio rerio OX=7955 GN=zgc:136664 PE=2 SV=1
6	Q61324	0.0	1448	712	0.971	0.978	ARNT2_MOUSE Aryl hydrocarbon receptor nuclear translocator 2 OS=Mus musculus OX=10090 GN=Arnt2 PE=1 SV=2
7	Q64FF8	0.0	530	404	0.351	0.624	Q64FF8_DANRE Aryl hydrocarbon receptor nuclear translocator isoform b OS=Danio rerio OX=7955 GN=zgc:136664 PE=2 SV=1
8	Q64FF9	0.0	638	503	0.424	0.604	Q64FF9_DANRE Aryl hydrocarbon receptor nuclear translocator OS=Danio rerio OX=7955 GN=zgc:136664 PE=2 SV=1
9	Q78E60	0.0	1445	712	0.968	0.975	ARNT2_RAT Aryl hydrocarbon receptor nuclear translocator 2 OS=Rattus norvegicus OX=10116 GN=Arnt2 PE=2 SV=1
10	Q98SN3	0.0	837	805	0.629	0.560	Q98SN3_CHICK Aryl hydrocarbon receptor nuclear translocator OS=Gallus gallus OX=9031 PE=2 SV=1
11	Q9BE97	0.0	883	790	0.656	0.595	ARNT_BOVIN Aryl hydrocarbon receptor nuclear translocator OS=Bos taurus OX=9913 GN=ARNT PE=1 SV=1
12	Q9DG12	0.0	1212	737	0.856	0.833	ARNT2_DANRE Aryl hydrocarbon receptor nuclear translocator 2 OS=Danio rerio OX=7955 GN=arnt2 PE=1 SV=2
13	Q9HBZ2	0.0	1493	717	1.000	1.000	ARNT2_HUMAN Aryl hydrocarbon receptor nuclear translocator 2 OS=Homo sapiens OX=9606 GN=ARNT2 PE=1 SV=2
14	X5DQN9	0.0	1493	717	1.000	1.000	X5DQN9_HUMAN Aryl-hydrocarbon receptor nuclear translocator 2 isoform D (Fragment) OS=Homo sapiens OX=9606 GN=ARNT2 PE=2 SV=1
15	O15945	2.79e-172	510	642	0.343	0.383	ARNT_DROME Aryl hydrocarbon receptor nuclear translocator homolog OS=Drosophila melanogaster OX=7227 GN=tgo PE=1 SV=3
16	O43392	1.13e-156	458	328	0.314	0.686	O43392_HUMAN Aryl hydrocarbon receptor nuclear translocator OS=Homo sapiens OX=9606 GN=ARNT PE=2 SV=1
17	Q86TN1	7.21e-149	434	217	0.290	0.959	Q86TN1_HUMAN ARNT2 protein OS=Homo sapiens OX=9606 GN=ARNT2 PE=1 SV=1
18	O02219	3.83e-115	356	453	0.262	0.415	AHA1_CAEEL Aryl hydrocarbon receptor nuclear translocator homolog OS=Caenorhabditis elegans OX=6239 GN=aha-1 PE=1 SV=1
19	Q8JIG1	5.88e-108	343	622	0.245	0.283	Q8JIG1_DANRE Aryl hydrocarbon receptor nuclear translocator-like 1b OS=Danio rerio OX=7955 GN=bmal1b PE=2 SV=1
20	Q9I879	5.23e-107	340	626	0.234	0.268	Q9I879_DANRE Aryl hydrocarbon receptor nuclear translocator-like 1a OS=Danio rerio OX=7955 GN=bmal1a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	3e-11	54.4	Helix-loop-helix DNA-binding domain
2	PF00989 PAS	6.6e-20	82.6	PAS fold
3	PF14598 PAS_11	4e-19	80.1	PAS domain
4	PF08446 PAS_2	56	15.8	PAS fold
5	PF08447 PAS_3	5.8e-21	85.9	PAS fold
6	PF08448 PAS_4	0.5	22.0	PAS fold
7	PF13426 PAS_9	2e-08	45.8	PAS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000011184

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000010206	0.989	Hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
2	60711.ENSCSAP00000009641	0.982	Endothelial PAS domain protein 1
3	60711.ENSCSAP00000009667	0.922	Uncharacterized protein
4	60711.ENSCSAP00000014057	0.887	Aryl hydrocarbon receptor nuclear translocator
5	60711.ENSCSAP00000004466	0.864	Neuronal PAS domain protein 4
6	60711.ENSCSAP00000002153	0.856	E1A binding protein p300
7	60711.ENSCSAP00000005901	0.827	CREB binding protein
8	60711.ENSCSAP00000010381	0.824	Belongs to the cytochrome P450 family.
9	60711.ENSCSAP00000010768	0.817	Single-minded family bHLH transcription factor 1
10	60711.ENSCSAP00000011741	0.800	Neuronal PAS domain protein 3
11	60711.ENSCSAP00000004803	0.796	Single-minded family bHLH transcription factor 2
12	60711.ENSCSAP00000015044	0.793	Neuronal PAS domain protein 1
13	60711.ENSCSAP00000013463	0.774	Aryl-hydrocarbon receptor repressor
14	60711.ENSCSAP00000014974	0.738	Hypoxia inducible factor 3, alpha subunit
15	60711.ENSCSAP00000008870	0.730	MAGE family member D1
16	60711.ENSCSAP00000016047	0.725	Nuclear receptor corepressor 2
17	60711.ENSCSAP00000008316	0.680	Vascular endothelial growth factor A
18	60711.ENSCSAP00000004437	0.673	annotation not available
19	60711.ENSCSAP00000003766	0.669	Sirtuin 1
20	60711.ENSCSAP00000004853	0.647	Nuclear receptor corepressor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0046982	0.999	protein heterodimerization activity
GO:1990837	0.996	sequence-specific double-stranded DNA binding
GO:0000976	0.756	transcription cis-regulatory region binding
GO:0008134	0.633	transcription factor binding
GO:0140297	0.539	DNA-binding transcription factor binding
GO:0061629	0.337	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0000977	0.313	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0050789	0.990	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0048518	0.975	positive regulation of biological process
GO:0019222	0.973	regulation of metabolic process
GO:0060255	0.961	regulation of macromolecule metabolic process
GO:0080090	0.958	regulation of primary metabolic process
GO:0051171	0.958	regulation of nitrogen compound metabolic process
GO:0031323	0.958	regulation of cellular metabolic process
GO:0010468	0.953	regulation of gene expression
GO:0031326	0.953	regulation of cellular biosynthetic process
GO:0051252	0.951	regulation of RNA metabolic process
GO:0010604	0.938	positive regulation of macromolecule metabolic process
GO:0045893	0.926	positive regulation of DNA-templated transcription
GO:0001666	0.921	response to hypoxia
GO:0032501	0.831	multicellular organismal process
GO:0006357	0.769	regulation of transcription by RNA polymerase II
GO:0007275	0.764	multicellular organism development
GO:0045944	0.654	positive regulation of transcription by RNA polymerase II
GO:0042221	0.559	response to chemical
GO:0009987	0.540	cellular process
GO:0048731	0.512	system development
GO:0051716	0.322	cellular response to stimulus
GO:0048519	0.317	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.712	cytoplasm
GO:0032991	0.476	protein-containing complex
GO:0005829	0.429	cytosol
GO:0005667	0.310	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]