StarFunc result for job id Q9HC10

User Input

>input (1997 residues)
MALLIHLKTVSELRGRGDRIAKVTFRGQSFYSRVLENCEDVADFDETFRWPVASSIDRNE
MLEIQVFNYSKVFSNKLIGTFRMVLQKVVEESHVEVTDTLIDDNNAIIKTSLCVEVRYQA
TDGTVGSWDDGDFLGDESLQEEEKDSQETDGLLPGSRPSSRPPGEKSFRRAGRSVFSAMK
LGKNRSHKEEPQRPDEPAVLEMEDLDHLAIRLGDGLDPDSVSLASVTALTTNVSNKRSKP
DIKMEPSAGRPMDYQVSITVIEARQLVGLNMDPVVCVEVGDDKKYTSMKESTNCPYYNEY
FVFDFHVSPDVMFDKIIKISVIHSKNLLRSGTLVGSFKMDVGTVYSQPEHQFHHKWAILS
DPDDISSGLKGYVKCDVAVVGKGDNIKTPHKANETDEDDIEGNLLLPEGVPPERQWARFY
VKIYRAEGLPRMNTSLMANVKKAFIGENKDLVDPYVQVFFAGQKGKTSVQKSSYEPLWNE
QVVFTDLFPPLCKRMKVQIRDSDKVNDVAIGTHFIDLRKISNDGDKGFLPTLGPAWVNMY
GSTRNYTLLDEHQDLNEGLGEGVSFRARLLLGLAVEIVDTSNPELTSSTEVQVEQATPIS
ESCAGKMEEFFLFGAFLEASMIDRRNGDKPITFEVTIGNYGNEVDGLSRPQRPRPRKEPG
DEEEVDLIQNASDDEAGDAGDLASVSSTPPMRPQVTDRNYFHLPYLERKPCIYIKSWWPD
QRRRLYNANIMDHIADKLEEGLNDIQEMIKTEKSYPERRLRGVLEELSCGCCRFLSLADK
DQGHSSRTRLDRERLKSCMRELENMGQQARMLRAQVKRHTVRDKLRLCQNFLQKLRFLAD
EPQHSIPDIFIWMMSNNKRVAYARVPSKDLLFSIVEEETGKDCAKVKTLFLKLPGKRGFG
SAGWTVQAKVELYLWLGLSKQRKEFLCGLPCGFQEVKAAQGLGLHAFPPVSLVYTKKQAF
QLRAHMYQARSLFAADSSGLSDPFARVFFINQSQCTEVLNETLCPTWDQMLVFDNLELYG
EAHELRDDPPIIVIEIYDQDSMGKADFMGRTFAKPLVKMADEAYCPPRFPPQLEYYQIYR
GNATAGDLLAAFELLQIGPAGKADLPPINGPVDVDRGPIMPVPMGIRPVLSKYRVEVLFW
GLRDLKRVNLAQVDRPRVDIECAGKGVQSSLIHNYKKNPNFNTLVKWFEVDLPENELLHP
PLNIRVVDCRAFGRYTLVGSHAVSSLRRFIYRPPDRSAPSWNTTVRLLRRCRVLCNGGSS
SHSTGEVVVTMEPEVPIKKLETMVKLDATSEAVVKVDVAEEEKEKKKKKKGTAEEPEEEE
PDESMLDWWSKYFASIDTMKEQLRQQEPSGIDLEEKEEVDNTEGLKGSMKGKEKARAAKE
EKKKKTQSSGSGQGSEAPEKKKPKIDELKVYPKELESEFDNFEDWLHTFNLLRGKTGDDE
DGSTEEERIVGRFKGSLCVYKVPLPEDVSREAGYDSTYGMFQGIPSNDPINVLVRVYVVR
ATDLHPADINGKADPYIAIRLGKTDIRDKENYISKQLNPVFGKSFDIEASFPMESMLTVA
VYDWDLVGTDDLIGETKIDLENRFYSKHRATCGIAQTYSTHGYNIWRDPMKPSQILTRLC
KDGKVDGPHFGPPGRVKVANRVFTGPSEIEDENGQRKPTDEHVALLALRHWEDIPRAGCR
LVPEHVETRPLLNPDKPGIEQGRLELWVDMFPMDMPAPGTPLDISPRKPKKYELRVIIWN
TDEVVLEDDDFFTGEKSSDIFVRGWLKGQQEDKQDTDVHYHSLTGEGNFNWRYLFPFDYL
AAEEKIVISKKESMFSWDETEYKIPARLTLQIWDADHFSADDFLGAIELDLNRFPRGAKT
AKQCTMEMATGEVDVPLVSIFKQKRVKGWWPLLARNENDEFELTGKVEAELHLLTAEEAE
KNPVGLARNEPDPLEKPNRPDTSFIWFLNPLKSARYFLWHTYRWLLLKLLLLLLLLLLLA
LFLYSVPGYLVKKILGA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B7Z0E5	0.569	0.676	0.000	1647	0.203	0.246	B7Z0E5.pdb.gz	B7Z0E5_DROME Misfire, isoform F OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
2	AFDB:E7F4H1	0.574	0.550	0.000	2097	0.341	0.324	E7F4H1.pdb.gz	E7F4H1_DANRE Dysferlin OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=2 SV=2
3	AFDB:E7FGH7	0.689	0.762	0.000	1790	0.448	0.499	E7FGH7.pdb.gz
4	AFDB:F8W4A8	0.790	0.885	0.000	1773	0.680	0.766	F8W4A8.pdb.gz	F8W4A8_DANRE Otoferlin b OS=Danio rerio OX=7955 GN=otofb PE=4 SV=1
5	AFDB:Q5SPC5	0.847	0.849	0.000	1992	0.766	0.768	Q5SPC5.pdb.gz	OTOF_DANRE Otoferlin OS=Danio rerio OX=7955 GN=otof PE=3 SV=1
6	AFDB:Q9ERC5	0.796	0.798	0.000	1993	0.937	0.939	Q9ERC5.pdb.gz	OTOF_RAT Otoferlin OS=Rattus norvegicus OX=10116 GN=Otof PE=1 SV=2
7	AFDB:Q9ESD7	0.570	0.547	0.000	2090	0.339	0.324	Q9ESD7.pdb.gz	DYSF_MOUSE Dysferlin OS=Mus musculus OX=10090 GN=Dysf PE=1 SV=3
8	AFDB:Q9ESF1	0.803	0.803	0.000	1997	0.948	0.948	Q9ESF1.pdb.gz	OTOF_MOUSE Otoferlin OS=Mus musculus OX=10090 GN=Otof PE=1 SV=1
9	AFDB:Q12466	0.076	0.116	5.958E-28	1186	0.065	0.110	Q12466.pdb.gz	TCB1_YEAST Tricalbin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TCB1 PE=1 SV=1
10	AFDB:P48231	0.080	0.123	1.020E-27	1178	0.066	0.112	P48231.pdb.gz	TCB2_YEAST Tricalbin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TCB2 PE=1 SV=1
11	PDB:6kxkD	0.057	0.185	6.446E-10	553	0.021	0.076	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
12	PDB:5iz5B	0.060	0.143	7.058E-9	746	0.022	0.058	5iz5B.pdb.gz
13	PDB:5iz5A	0.065	0.141	4.067E-7	757	0.023	0.061	5iz5A.pdb.gz
14	PDB:5ixcA	0.062	0.150	1.134E-6	684	0.020	0.058	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:5a52A	0.049	0.514	1.073E-5	154	0.012	0.149	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
16	PDB:5a50A	0.053	0.518	1.126E-5	165	0.019	0.224	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
17	PDB:5izrC	0.059	0.154	1.369E-5	659	0.019	0.056	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
18	PDB:3nsjA	0.055	0.196	1.510E-5	530	0.017	0.064	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
19	PDB:1cjyA	0.054	0.159	1.927E-5	633	0.012	0.036	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
20	PDB:4rj9A	0.050	0.525	3.298E-5	161	0.008	0.099	4rj9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A6X1	0.0	685	2029	0.204	0.201	D4A6X1_RAT Dysferlin OS=Rattus norvegicus OX=10116 GN=Dysf PE=3 SV=2
2	E0CZ42	0.0	1799	1862	0.455	0.488	E0CZ42_MOUSE Fer-1-like 6 (C. elegans) OS=Mus musculus OX=10090 GN=Fer1l6 PE=1 SV=1
3	F8W4A8	0.0	2820	1773	0.679	0.765	F8W4A8_DANRE Otoferlin b OS=Danio rerio OX=7955 GN=otofb PE=4 SV=1
4	O75923	0.0	692	2080	0.207	0.199	DYSF_HUMAN Dysferlin OS=Homo sapiens OX=9606 GN=DYSF PE=1 SV=1
5	Q5SPC5	0.0	3153	1992	0.768	0.770	OTOF_DANRE Otoferlin OS=Danio rerio OX=7955 GN=otof PE=3 SV=1
6	Q9ERC5	0.0	3803	1993	0.936	0.938	OTOF_RAT Otoferlin OS=Rattus norvegicus OX=10116 GN=Otof PE=1 SV=2
7	Q9ESD7	0.0	681	2090	0.201	0.192	DYSF_MOUSE Dysferlin OS=Mus musculus OX=10090 GN=Dysf PE=1 SV=3
8	Q9ESF1	0.0	3819	1997	0.948	0.948	OTOF_MOUSE Otoferlin OS=Mus musculus OX=10090 GN=Otof PE=1 SV=1
9	Q9HC10	0.0	4129	1997	1.000	1.000	OTOF_HUMAN Otoferlin OS=Homo sapiens OX=9606 GN=OTOF PE=1 SV=3
10	Q9NZM1	0.0	653	2061	0.197	0.191	MYOF_HUMAN Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1
11	F1QIS3	2.99e-152	523	2088	0.142	0.136	F1QIS3_DANRE Dysferlin isoform X9 OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=3 SV=3
12	E7F4H1	3.91e-152	523	2097	0.142	0.135	E7F4H1_DANRE Dysferlin OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=2 SV=2
13	F6IA09	6.03e-151	519	2088	0.142	0.136	F6IA09_DANRE Dysferlin OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=2 SV=1
14	Q69ZN7	4.91e-138	480	2048	0.135	0.132	MYOF_MOUSE Myoferlin OS=Mus musculus OX=10090 GN=Myof PE=1 SV=2
15	B7Z0E8	2.04e-90	311	648	0.095	0.293	B7Z0E8_DROME Misfire, isoform J OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
16	B7Z0E7	3.25e-86	313	1351	0.095	0.141	B7Z0E7_DROME Misfire, isoform D OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
17	B7Z0E6	1.36e-85	312	1439	0.095	0.132	B7Z0E6_DROME Misfire, isoform I OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
18	B7Z0E5	4.59e-85	312	1647	0.095	0.115	B7Z0E5_DROME Misfire, isoform F OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
19	B7Z0F0	8.31e-81	292	1045	0.089	0.170	B7Z0F0_DROME Misfire, isoform B OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
20	B7Z0E9	1.96e-79	293	1398	0.089	0.127	B7Z0E9_DROME Misfire, isoform C OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	1.5e-75	261.5	C2 domain
2	PF08150 FerB	2.2e-29	113.1	FerB (NUC096) domain
3	PF08151 FerI	9.5e-17	72.1	FerI (NUC094) domain
4	PF16165 Ferlin_C	1.5e-29	114.4	Ferlin C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000272371

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222812	0.985	Syntaxin-1A
2	9606.ENSP00000314214	0.929	Vesicle-associated membrane protein 2
3	9606.ENSP00000345656	0.916	Vesicle-associated membrane protein-associated protein A
4	9606.ENSP00000312734	0.912	Ras-related protein Rab-8B
5	9606.ENSP00000288139	0.905	Voltage-dependent L-type calcium channel subunit alpha-1D
6	9606.ENSP00000294179	0.902	Syntaxin-5
7	9606.ENSP00000341625	0.902	Cytochrome b5
8	9606.ENSP00000358857	0.902	Emerin
9	9606.ENSP00000420076	0.901	Stress-associated endoplasmic reticulum protein 1
10	9606.ENSP00000216117	0.900	Heme oxygenase 1
11	9606.ENSP00000223641	0.900	Protein transport protein Sec61 subunit beta
12	9606.ENSP00000345774	0.900	Fatty aldehyde dehydrogenase
13	9606.ENSP00000383719	0.900	Ubiquitin-conjugating enzyme E2 J2
14	9606.ENSP00000388337	0.900	Protein transport protein Sec61 subunit gamma
15	9606.ENSP00000254976	0.880	Synaptosomal-associated protein 25
16	9606.ENSP00000358994	0.865	Unconventional myosin-VI
17	9606.ENSP00000205890	0.850	Unconventional myosin-XV
18	9606.ENSP00000297784	0.819	Transmembrane channel-like protein 1
19	9606.ENSP00000316909	0.819	Vesicular glutamate transporter 3
20	9606.ENSP00000311825	0.790	C-terminal-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005515	1.000	protein binding
GO:0043167	0.710	ion binding
GO:0005509	0.688	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0016043	0.984	cellular component organization
GO:0032501	0.974	multicellular organismal process
GO:0065007	0.956	biological regulation
GO:0061024	0.925	membrane organization
GO:0007605	0.919	sensory perception of sound
GO:0051179	0.787	localization
GO:0050896	0.785	response to stimulus
GO:0051234	0.779	establishment of localization
GO:0050789	0.759	regulation of biological process
GO:0048856	0.753	anatomical structure development
GO:0006810	0.746	transport
GO:0050794	0.673	regulation of cellular process
GO:0061025	0.666	membrane fusion
GO:0007154	0.490	cell communication
GO:0023052	0.473	signaling
GO:0006836	0.468	neurotransmitter transport
GO:0051641	0.389	cellular localization
GO:0007267	0.314	cell-cell signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005737	0.999	cytoplasm
GO:0012505	0.996	endomembrane system
GO:0005829	0.994	cytosol
GO:0005886	0.993	plasma membrane
GO:0043231	0.987	intracellular membrane-bounded organelle
GO:0005783	0.735	endoplasmic reticulum
GO:0031090	0.678	organelle membrane
GO:0031982	0.656	vesicle
GO:0031410	0.547	cytoplasmic vesicle
GO:0098588	0.355	bounding membrane of organelle
GO:0030054	0.305	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]