StarFunc result for job id Q9HC29

User Input

>input (1040 residues)
MGEEGGSASHDEEERASVLLGHSPGCEMCSQEAFQAQRSQLVELLVSGSLEGFESVLDWL
LSWEVLSWEDYEGFHLLGQPLSHLARRLLDTVWNKGTWACQKLIAAAQEAQADSQSPKLH
GCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPIFTPSQR
ARRLLDLATVKANGLAAFLLQHVQELPVPLALPLEAATCKKYMAKLRTTVSAQSRFLSTY
DGAETLCLEDIYTENVLEVWADVGMAGPPQKSPATLGLEELFSTPGHLNDDADTVLVVGE
AGSGKSTLLQRLHLLWAAGQDFQEFLFVFPFSCRQLQCMAKPLSVRTLLFEHCCWPDVGQ
EDIFQLLLDHPDRVLLTFDGFDEFKFRFTDRERHCSPTDPTSVQTLLFNLLQGNLLKNAR
KVVTSRPAAVSAFLRKYIRTEFNLKGFSEQGIELYLRKRHHEPGVADRLIRLLQETSALH
GLCHLPVFSWMVSKCHQELLLQEGGSPKTTTDMYLLILQHFLLHATPPDSASQGLGPSLL
RGRLPTLLHLGRLALWGLGMCCYVFSAQQLQAAQVSPDDISLGFLVRAKGVVPGSTAPLE
FLHITFQCFFAAFYLALSADVPPALLRHLFNCGRPGNSPMARLLPTMCIQASEGKDSSVA
ALLQKAEPHNLQITAAFLAGLLSREHWGLLAECQTSEKALLRRQACARWCLARSLRKHFH
SIPPAAPGEAKSVHAMPGFIWLIRSLYEMQEERLARKAARGLNVGHLKLTFCSVGPTECA
ALAFVLQHLRRPVALQLDYNSVGDIGVEQLLPCLGVCKALYLRDNNISDRGICKLIECAL
HCEQLQKLALFNNKLTDGCAHSMAKLLACRQNFLALRLGNNYITAAGAQVLAEGLRGNTS
LQFLGFWGNRVGDEGAQALAEALGDHQSLRWLSLVGNNIGSVGAQALALMLAKNVMLEEL
CLEENHLQDEGVCSLAEGLKKNSSLKILKLSNNCITYLGAEALLQALERNDTILEVWLRG
NTFSLEEVDKLGCRDTRLLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K4Z7	0.800	0.839	0.000	989	0.762	0.801	A0A0G2K4Z7.pdb.gz	A0A0G2K4Z7_RAT Nucleotide-binding oligomerization domain containing 2 OS=Rattus norvegicus OX=10116 GN=Nod2 PE=3 SV=2
2	AFDB:Q6E804	0.930	0.954	0.000	1013	0.791	0.812	Q6E804.pdb.gz	NOD2_BOVIN Nucleotide-binding oligomerization domain-containing protein 2 OS=Bos taurus OX=9913 GN=NOD2 PE=2 SV=1
3	AFDB:Q8K3Z0	0.878	0.894	0.000	1020	0.774	0.789	Q8K3Z0.pdb.gz	NOD2_MOUSE Nucleotide-binding oligomerization domain-containing protein 2 OS=Mus musculus OX=10090 GN=Nod2 PE=1 SV=1
4	AFDB:Q9HC29	1.000	1.000	0.000	1040	1.000	1.000	Q9HC29.pdb.gz	NOD2_HUMAN Nucleotide-binding oligomerization domain-containing protein 2 OS=Homo sapiens OX=9606 GN=NOD2 PE=1 SV=1
5	AFDB:F8W3K2	0.706	0.748	3.236E-86	980	0.448	0.476	F8W3K2.pdb.gz	F8W3K2_DANRE NOD2a protein OS=Danio rerio OX=7955 GN=card15 PE=2 SV=1
6	AFDB:A0A0K0KIB0	0.724	0.787	8.791E-62	954	0.284	0.309	A0A0K0KIB0.pdb.gz	A0A0K0KIB0_ONCMY Nucleotide-binding oligomerization domain-containing protein 1 OS=Oncorhynchus mykiss OX=8022 GN=NOD1 PE=2 SV=1
7	AFDB:D4ADT7	0.730	0.795	3.830E-61	953	0.288	0.315	D4ADT7.pdb.gz	D4ADT7_RAT Nucleotide-binding oligomerization domain containing 1 OS=Rattus norvegicus OX=10116 GN=Nod1 PE=3 SV=1
8	AFDB:Q9Y239	0.502	0.545	9.659E-61	953	0.298	0.325	Q9Y239.pdb.gz	NOD1_HUMAN Nucleotide-binding oligomerization domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NOD1 PE=1 SV=1
9	AFDB:X1WGQ4	0.399	0.456	9.824E-51	903	0.242	0.279	X1WGQ4.pdb.gz
10	AFDB:E9Q5R7	0.475	0.470	1.145E-39	1054	0.234	0.231	E9Q5R7.pdb.gz	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
11	PDB:7pzcA	0.457	0.467	3.339E-28	1010	0.223	0.230	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
12	PDB:7lfhA	0.464	0.567	1.792E-23	806	0.198	0.256	7lfhA.pdb.gz
13	PDB:4kxfP	0.337	0.399	3.402E-22	866	0.140	0.169	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
14	PDB:6npyA	0.350	0.442	1.059E-21	798	0.187	0.243	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
15	PDB:3jblA	0.213	0.239	5.163E-14	909	0.146	0.167	3jblA.pdb.gz
16	PDB:6b5bA	0.230	0.203	1.022E-12	1199	0.153	0.133	6b5bA.pdb.gz
17	PDB:1a4yA	0.256	0.526	9.100E-12	460	0.093	0.211	1a4yA.pdb.gz
18	PDB:6o60C	0.245	0.599	4.835E-8	389	0.065	0.175	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
19	PDB:6j5wA	0.162	0.196	1.956E-6	816	0.102	0.130	6j5wA.pdb.gz	Ligand-triggered allosteric ADP release primes a plant NLR complex.
20	PDB:1k5dC	0.216	0.579	9.271E-6	344	0.055	0.166	1k5dC.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K4Z7	0.0	1606	1034	0.776	0.780	A0A0G2K4Z7_RAT Nucleotide-binding oligomerization domain containing 2 OS=Rattus norvegicus OX=10116 GN=Nod2 PE=3 SV=2
2	D4A5W3	0.0	1503	932	0.717	0.800	D4A5W3_RAT Nucleotide-binding oligomerization domain containing 2 OS=Rattus norvegicus OX=10116 GN=Nod2 PE=3 SV=1
3	F8W3K2	0.0	860	980	0.462	0.490	F8W3K2_DANRE NOD2a protein OS=Danio rerio OX=7955 GN=card15 PE=2 SV=1
4	Q6E804	0.0	1661	1013	0.791	0.812	NOD2_BOVIN Nucleotide-binding oligomerization domain-containing protein 2 OS=Bos taurus OX=9913 GN=NOD2 PE=2 SV=1
5	Q80SY9	0.0	1622	1013	0.772	0.793	Q80SY9_MOUSE NOD2 OS=Mus musculus OX=10090 GN=Nod2 PE=2 SV=1
6	Q8K3Z0	0.0	1625	1020	0.774	0.789	NOD2_MOUSE Nucleotide-binding oligomerization domain-containing protein 2 OS=Mus musculus OX=10090 GN=Nod2 PE=1 SV=1
7	Q9HC29	0.0	2120	1040	1.000	1.000	NOD2_HUMAN Nucleotide-binding oligomerization domain-containing protein 2 OS=Homo sapiens OX=9606 GN=NOD2 PE=1 SV=1
8	D4ADT7	9.07e-138	440	953	0.312	0.340	D4ADT7_RAT Nucleotide-binding oligomerization domain containing 1 OS=Rattus norvegicus OX=10116 GN=Nod1 PE=3 SV=1
9	Q8BHB0	5.60e-137	438	953	0.308	0.336	NOD1_MOUSE Nucleotide-binding oligomerization domain-containing protein 1 OS=Mus musculus OX=10090 GN=Nod1 PE=1 SV=1
10	Q9Y239	3.11e-136	436	953	0.315	0.344	NOD1_HUMAN Nucleotide-binding oligomerization domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NOD1 PE=1 SV=1
11	A0A060X8V7	2.87e-122	399	951	0.270	0.295	A0A060X8V7_ONCMY Nucleotide-binding oligomerization domain-containing protein 1 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00047677001 PE=4 SV=1
12	A0A0K0KIB0	2.26e-121	397	954	0.270	0.295	A0A0K0KIB0_ONCMY Nucleotide-binding oligomerization domain-containing protein 1 OS=Oncorhynchus mykiss OX=8022 GN=NOD1 PE=2 SV=1
13	C3VPR7	1.61e-54	209	1065	0.215	0.210	C3VPR7_HUMAN NLRC3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=2 SV=1
14	Q7RTR2	1.61e-54	209	1065	0.215	0.210	NLRC3_HUMAN NLR family CARD domain-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=1 SV=2
15	H3BLT9	2.04e-54	209	1112	0.215	0.201	H3BLT9_HUMAN NLR family CARD domain containing 3 OS=Homo sapiens OX=9606 GN=NLRC3 PE=1 SV=2
16	Q5DU56	1.37e-47	187	1064	0.204	0.199	NLRC3_MOUSE Protein NLRC3 OS=Mus musculus OX=10090 GN=Nlrc3 PE=1 SV=2
17	E9Q5R7	1.49e-37	155	1054	0.210	0.207	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
18	D4A523	2.36e-36	151	1035	0.208	0.209	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
19	Q8R4B8	5.21e-36	150	1033	0.200	0.201	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3 OS=Mus musculus OX=10090 GN=Nlrp3 PE=1 SV=1
20	P59046	6.53e-36	150	1061	0.195	0.191	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	0.87	21.4	AAA ATPase domain
2	PF13238 AAA_18	3.2e+02	13.3	AAA domain
3	PF13401 AAA_22	17	17.1	AAA domain
4	PF13481 AAA_25	51	14.9	AAA domain
5	PF13555 AAA_29	12	17.0	P-loop containing region of AAA domain
6	PF13604 AAA_30	33	15.6	AAA domain
7	PF13671 AAA_33	6.3e+02	11.9	AAA domain
8	PF00005 ABC_tran	3.4e+02	13.1	ABC transporter
9	PF00619 CARD	2.1e-26	103.1	Caspase recruitment domain
10	PF12799 LRR_4	0.25	23.1	Leucine Rich repeats (2 copies)
11	PF13516 LRR_6	2.9e-14	62.9	Leucine Rich repeat
12	PF13855 LRR_8	13	16.9	Leucine rich repeat
13	PF05729 NACHT	6.9e-38	141.7	NACHT domain
14	PF00931 NB-ARC	1.6e+02	12.8	NB-ARC domain
15	PF17776 NLRC4_HD2	2.5e-16	71.9	NLRC4 helical domain HD2
16	PF17779 NOD2_WH	8.1e-08	43.7	NOD2 winged helix domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300589

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000220751	0.999	Receptor-interacting serine/threonine-protein kinase 2
2	9606.ENSP00000375872	0.999	Autophagy-related protein 16-1
3	9606.ENSP00000401980	0.997	Mitochondrial antiviral-signaling protein
4	9606.ENSP00000426632	0.997	Erbin
5	9606.ENSP00000360797	0.994	Caspase recruitment domain-containing protein 9
6	9606.ENSP00000433138	0.990	Caspase-1
7	9606.ENSP00000260010	0.985	Toll-like receptor 2
8	9606.ENSP00000342278	0.980	2'-5'-oligoadenylate synthase 2
9	9606.ENSP00000477613	0.966	Baculoviral IAP repeat-containing protein 2
10	9606.ENSP00000483825	0.966	NF-kappa-B essential modulator
11	9606.ENSP00000392025	0.965	Ubiquitin carboxyl-terminal hydrolase CYLD
12	9606.ENSP00000428220	0.965	Immunity-related GTPase family M protein
13	9606.ENSP00000481570	0.961	Tumor necrosis factor alpha-induced protein 3
14	9606.ENSP00000263464	0.960	Baculoviral IAP repeat-containing protein 3
15	9606.ENSP00000262395	0.954	TNF receptor-associated factor 4
16	9606.ENSP00000295025	0.948	Proto-oncogene c-Rel
17	9606.ENSP00000359424	0.944	Inhibitor of nuclear factor kappa-B kinase subunit alpha
18	9606.ENSP00000430684	0.943	Inhibitor of nuclear factor kappa-B kinase subunit beta
19	9606.ENSP00000480499	0.929	E3 ubiquitin-protein ligase Itchy homolog
20	9606.ENSP00000358335	0.927	Mitogen-activated protein kinase kinase kinase 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0097367	0.994	carbohydrate derivative binding
GO:0005515	0.994	protein binding
GO:0042277	0.992	peptide binding
GO:0042834	0.953	peptidoglycan binding
GO:0019899	0.850	enzyme binding
GO:0038187	0.769	pattern recognition receptor activity
GO:0032500	0.694	muramyl dipeptide binding
GO:0050700	0.410	CARD domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.985	response to stimulus
GO:0050794	0.985	regulation of cellular process
GO:0009605	0.982	response to external stimulus
GO:0010604	0.982	positive regulation of macromolecule metabolic process
GO:0010468	0.981	regulation of gene expression
GO:0051716	0.976	cellular response to stimulus
GO:0010033	0.974	response to organic substance
GO:0048522	0.974	positive regulation of cellular process
GO:0001817	0.974	regulation of cytokine production
GO:0010628	0.974	positive regulation of gene expression
GO:0048583	0.964	regulation of response to stimulus
GO:0002720	0.960	positive regulation of cytokine production involved in immune response
GO:0009607	0.951	response to biotic stimulus
GO:0044419	0.946	biological process involved in interspecies interaction between organisms
GO:0048584	0.934	positive regulation of response to stimulus
GO:0051707	0.930	response to other organism
GO:0023052	0.928	signaling
GO:0007154	0.928	cell communication
GO:0002376	0.927	immune system process
GO:1901699	0.925	cellular response to nitrogen compound
GO:0007165	0.924	signal transduction
GO:0071216	0.907	cellular response to biotic stimulus
GO:0032103	0.906	positive regulation of response to external stimulus
GO:0002831	0.904	regulation of response to biotic stimulus
GO:0031349	0.904	positive regulation of defense response
GO:0050778	0.901	positive regulation of immune response
GO:0071310	0.891	cellular response to organic substance
GO:0010243	0.889	response to organonitrogen compound
GO:0045088	0.888	regulation of innate immune response
GO:0023051	0.886	regulation of signaling
GO:0010646	0.886	regulation of cell communication
GO:0098542	0.884	defense response to other organism
GO:0002237	0.884	response to molecule of bacterial origin
GO:0051090	0.871	regulation of DNA-binding transcription factor activity
GO:0009966	0.865	regulation of signal transduction
GO:0043122	0.861	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043123	0.854	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:1901652	0.843	response to peptide
GO:0002758	0.839	innate immune response-activating signaling pathway
GO:0071219	0.823	cellular response to molecule of bacterial origin
GO:1901701	0.780	cellular response to oxygen-containing compound
GO:0009719	0.770	response to endogenous stimulus
GO:1903555	0.770	regulation of tumor necrosis factor superfamily cytokine production
GO:0032652	0.747	regulation of interleukin-1 production
GO:0032675	0.746	regulation of interleukin-6 production
GO:0032680	0.745	regulation of tumor necrosis factor production
GO:0044093	0.742	positive regulation of molecular function
GO:0032651	0.725	regulation of interleukin-1 beta production
GO:0032755	0.721	positive regulation of interleukin-6 production
GO:0032732	0.712	positive regulation of interleukin-1 production
GO:0032731	0.701	positive regulation of interleukin-1 beta production
GO:1901222	0.699	regulation of NIK/NF-kappaB signaling
GO:0051173	0.698	positive regulation of nitrogen compound metabolic process
GO:0009595	0.696	detection of biotic stimulus
GO:0043410	0.686	positive regulation of MAPK cascade
GO:1901224	0.681	positive regulation of NIK/NF-kappaB signaling
GO:0071495	0.679	cellular response to endogenous stimulus
GO:1903557	0.674	positive regulation of tumor necrosis factor superfamily cytokine production
GO:0042127	0.670	regulation of cell population proliferation
GO:0032760	0.664	positive regulation of tumor necrosis factor production
GO:0071417	0.628	cellular response to organonitrogen compound
GO:0002703	0.615	regulation of leukocyte mediated immunity
GO:0032872	0.615	regulation of stress-activated MAPK cascade
GO:0050865	0.609	regulation of cell activation
GO:0046330	0.607	positive regulation of JNK cascade
GO:0002705	0.586	positive regulation of leukocyte mediated immunity
GO:0048519	0.548	negative regulation of biological process
GO:0008152	0.512	metabolic process
GO:0006955	0.490	immune response
GO:0031325	0.453	positive regulation of cellular metabolic process
GO:0071704	0.449	organic substance metabolic process
GO:0051246	0.449	regulation of protein metabolic process
GO:0050790	0.428	regulation of catalytic activity
GO:0007166	0.408	cell surface receptor signaling pathway
GO:0014070	0.397	response to organic cyclic compound
GO:0035556	0.384	intracellular signal transduction
GO:0051247	0.376	positive regulation of protein metabolic process
GO:0044238	0.372	primary metabolic process
GO:0048523	0.366	negative regulation of cellular process
GO:0002694	0.353	regulation of leukocyte activation
GO:0045087	0.348	innate immune response
GO:0031399	0.347	regulation of protein modification process
GO:0044237	0.346	cellular metabolic process
GO:0051249	0.334	regulation of lymphocyte activation
GO:0050727	0.330	regulation of inflammatory response
GO:0002696	0.325	positive regulation of leukocyte activation
GO:0006807	0.323	nitrogen compound metabolic process
GO:0051251	0.312	positive regulation of lymphocyte activation
GO:0032501	0.307	multicellular organismal process
GO:0010941	0.303	regulation of cell death

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0016020	0.859	membrane
GO:0043226	0.839	organelle
GO:0043229	0.793	intracellular organelle
GO:0043231	0.747	intracellular membrane-bounded organelle
GO:0071944	0.540	cell periphery
GO:0005886	0.474	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]