StarFunc result for job id Q9HC35

User Input

>input (981 residues)
MDGFAGSLDDSISAASTSDVQDRLSALESRVQQQEDEITVLKAALADVLRRLAISEDHVA
SVKKSVSSKGQPSPRAVIPMSCITNGSGANRKPSHTSAVSIAGKETLSSAAKSGTEKKKE
KPQGQREKKEESHSNDQSPQIRASPSPQPSSQPLQIHRQTPESKNATPTKSIKRPSPAEK
SHNSWENSDDSRNKLSKIPSTPKLIPKVTKTADKHKDVIINQEGEYIKMFMRGRPITMFI
PSDVDNYDDIRTELPPEKLKLEWAYGYRGKDCRANVYLLPTGKIVYFIASVVVLFNYEER
TQRHYLGHTDCVKCLAIHPDKIRIATGQIAGVDKDGRPLQPHVRVWDSVTLSTLQIIGLG
TFERGVGCLDFSKADSGVHLCIIDDSNEHMLTVWDWQKKAKGAEIKTTNEVVLAVEFHPT
DANTIITCGKSHIFFWTWSGNSLTRKQGIFGKYEKPKFVQCLAFLGNGDVLTGDSGGVML
IWSKTTVEPTPGKGPKGVYQISKQIKAHDGSVFTLCQMRNGMLLTGGGKDRKIILWDHDL
NPEREIEVPDQYGTIRAVAEGKADQFLVGTSRNFILRGTFNDGFQIEVQGHTDELWGLAT
HPFKDLLLTCAQDRQVCLWNSMEHRLEWTRLVDEPGHCADFHPSGTVVAIGTHSGRWFVL
DAETRDLVSIHTDGNEQLSVMRYSIDGTFLAVGSHDNFIYLYVVSENGRKYSRYGRCTGH
SSYITHLDWSPDNKYIMSNSGDYEILYWDIPNGCKLIRNRSDCKDIDWTTYTCVLGFQVF
GVWPEGSDGTDINALVRSHNRKVIAVADDFCKVHLFQYPCSKAKAPSHKYSAHSSHVTNV
SFTHNDSHLISTGGKDMSIIQWKLVEKLSLPQNETVADTTLTKAPVSSTESVIQSNTPTP
PPSQPLNETAEEESRISSSPTLLENSLEQTVEPSEDHSEEESEEGSGDLGEPLYEEPCNE
ISKEQAKATLLEDQQDPSPSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B5MBZ0	0.697	0.690	0.000	992	0.999	0.988	B5MBZ0.pdb.gz	B5MBZ0_HUMAN EMAP like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3
2	AFDB:Q3UMY5	0.726	0.721	0.000	988	0.885	0.879	Q3UMY5.pdb.gz	EMAL4_MOUSE Echinoderm microtubule-associated protein-like 4 OS=Mus musculus OX=10090 GN=Eml4 PE=1 SV=1
3	AFDB:Q32P44	0.704	0.769	5.175E-100	896	0.457	0.500	Q32P44.pdb.gz	EMAL3_HUMAN Echinoderm microtubule-associated protein-like 3 OS=Homo sapiens OX=9606 GN=EML3 PE=1 SV=1
4	AFDB:O95834	0.641	0.965	3.183E-92	649	0.378	0.572	O95834.pdb.gz	EMAL2_HUMAN Echinoderm microtubule-associated protein-like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1
5	AFDB:Q9VUI3	0.613	0.560	1.305E-61	1076	0.223	0.204	Q9VUI3.pdb.gz	EMAL_DROME Echinoderm microtubule-associated protein-like CG42247 OS=Drosophila melanogaster OX=7227 GN=DCX-EMAP PE=2 SV=3
6	PDB:7rroe	0.488	0.757	5.693E-28	610	0.111	0.179	7rroe.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
7	PDB:7mqaLQ	0.430	0.496	7.240E-28	830	0.098	0.116	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
8	PDB:1nr0A	0.445	0.671	1.739E-25	610	0.105	0.169	1nr0A.pdb.gz
9	PDB:7mqaLO	0.396	0.463	1.834E-24	819	0.102	0.122	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
10	PDB:7ajuUL	0.384	0.468	2.130E-23	779	0.101	0.127	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
11	PDB:7ajtUA	0.385	0.441	2.235E-23	834	0.091	0.107	7ajtUA.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
12	PDB:7mq8LO	0.394	0.446	2.582E-23	848	0.105	0.121	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7d5sB2	0.418	0.471	4.382E-23	851	0.100	0.115	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
14	PDB:1pguB	0.411	0.618	1.538E-21	608	0.095	0.153	1pguB.pdb.gz	The structure of Aip1p, a WD repeat protein that regulates Cofilin-mediated actin depolymerization.
15	PDB:5m2nA	0.430	0.563	1.956E-21	711	0.088	0.121	5m2nA.pdb.gz
16	AFDB:P16649	0.160	0.214	2.012E-16	713	0.121	0.167	P16649.pdb.gz	TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TUP1 PE=1 SV=2
17	AFDB:P16371	0.154	0.206	7.025E-16	730	0.092	0.123	P16371.pdb.gz	GROU_DROME Protein groucho OS=Drosophila melanogaster OX=7227 GN=gro PE=1 SV=3
18	AFDB:K7EMK7	0.152	0.200	8.982E-15	744	0.096	0.126	K7EMK7.pdb.gz	K7EMK7_HUMAN TLE family member 2, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE2 PE=1 SV=1
19	AFDB:Q9FUY2	0.138	0.143	2.601E-13	931	0.087	0.091	Q9FUY2.pdb.gz	LEUNG_ARATH Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana OX=3702 GN=LUG PE=1 SV=2
20	AFDB:F4JUD2	0.136	0.137	1.100E-12	969	0.090	0.091	F4JUD2.pdb.gz	F4JUD2_ARATH Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana OX=3702 GN=LUG PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8RMY7	0.0	896	817	0.443	0.532	A0A2R8RMY7_DANRE EMAP-like 1 OS=Danio rerio OX=7955 GN=wu:fj01a06 PE=3 SV=1
2	B5MBZ0	0.0	2035	992	1.000	0.989	B5MBZ0_HUMAN EMAP like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3
3	E7EXY5	0.0	892	813	0.443	0.535	E7EXY5_DANRE EMAP-like 1 OS=Danio rerio OX=7955 GN=wu:fj01a06 PE=3 SV=1
4	O00423	0.0	922	815	0.453	0.545	EMAL1_HUMAN Echinoderm microtubule-associated protein-like 1 OS=Homo sapiens OX=9606 GN=EML1 PE=1 SV=3
5	O95834	0.0	821	649	0.380	0.575	EMAL2_HUMAN Echinoderm microtubule-associated protein-like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1
6	Q05BC3	0.0	911	814	0.453	0.545	EMAL1_MOUSE Echinoderm microtubule-associated protein-like 1 OS=Mus musculus OX=10090 GN=Eml1 PE=1 SV=1
7	Q32P44	0.0	865	896	0.403	0.441	EMAL3_HUMAN Echinoderm microtubule-associated protein-like 3 OS=Homo sapiens OX=9606 GN=EML3 PE=1 SV=1
8	Q3UMY5	0.0	1768	988	0.886	0.880	EMAL4_MOUSE Echinoderm microtubule-associated protein-like 4 OS=Mus musculus OX=10090 GN=Eml4 PE=1 SV=1
9	Q6P6T4	0.0	812	649	0.371	0.561	EMAL2_RAT Echinoderm microtubule-associated protein-like 2 OS=Rattus norvegicus OX=10116 GN=Eml2 PE=1 SV=1
10	Q9HC35	0.0	2042	981	1.000	1.000	EMAL4_HUMAN Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3
11	A0A0C4DGQ7	2.65e-171	508	427	0.236	0.543	A0A0C4DGQ7_HUMAN EMAP like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1
12	Q9VUI3	1.04e-112	375	1076	0.228	0.208	EMAL_DROME Echinoderm microtubule-associated protein-like CG42247 OS=Drosophila melanogaster OX=7227 GN=DCX-EMAP PE=2 SV=3
13	Q05BV3	5.35e-104	360	1969	0.217	0.108	EMAL5_HUMAN Echinoderm microtubule-associated protein-like 5 OS=Homo sapiens OX=9606 GN=EML5 PE=2 SV=3
14	C4ALD8	1.34e-86	299	888	0.205	0.226	C4ALD8_CAEEL HELP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=elp-1 PE=3 SV=1
15	O45487	1.75e-86	299	891	0.205	0.226	EMAL_CAEEL Echinoderm microtubule-associated protein-like elp-1 OS=Caenorhabditis elegans OX=6239 GN=elp-1 PE=3 SV=1
16	E9Q5M6	1.26e-18	94.4	1843	0.128	0.068	CFA44_MOUSE Cilia- and flagella-associated protein 44 OS=Mus musculus OX=10090 GN=Cfap44 PE=2 SV=1
17	Q96MT7	1.29e-17	91.3	1854	0.123	0.065	CFA44_HUMAN Cilia- and flagella-associated protein 44 OS=Homo sapiens OX=9606 GN=CFAP44 PE=1 SV=2
18	Q8TBY9	7.48e-17	88.6	1149	0.147	0.125	CF251_HUMAN Cilia- and flagella-associated protein 251 OS=Homo sapiens OX=9606 GN=CFAP251 PE=1 SV=2
19	A8J1V4	4.27e-16	86.3	1764	0.076	0.043	CFA44_CHLRE Cilia- and flagella-associated protein 44 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP44 PE=1 SV=1
20	Q57ZE4	1.97e-14	80.5	1027	0.157	0.150	Q57ZE4_TRYB2 Anaphase-promoting complex subunit 4-like WD40 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.30P12.250 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.00035	32.1	Anaphase-promoting complex subunit 4 WD40 domain
2	PF19681 DUF6183	3.1e+02	12.0	Family of unknown function (DUF6183)
3	PF03451 HELP	9.3e-25	97.6	HELP motif
4	PF04102 SlyX	99	15.0	SlyX
5	PF00400 WD40	3.2e-26	102.2	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000320663

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373700	0.998	ALK tyrosine kinase receptor
2	9606.ENSP00000256078	0.963	GTPase KRas
3	9606.ENSP00000407586	0.953	GTPase HRas
4	9606.ENSP00000263967	0.935	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
5	9606.ENSP00000356355	0.929	Serine/threonine-protein kinase Nek7
6	9606.ENSP00000362702	0.924	Serine/threonine-protein kinase Nek6
7	9606.ENSP00000238616	0.911	Serine/threonine-protein kinase Nek9
8	9606.ENSP00000357494	0.868	Proto-oncogene tyrosine-protein kinase ROS
9	9606.ENSP00000358548	0.867	GTPase NRas
10	9606.ENSP00000371067	0.855	Tyrosine-protein kinase JAK2
11	9606.ENSP00000275493	0.851	Epidermal growth factor receptor
12	9606.ENSP00000391676	0.850	Tyrosine-protein kinase JAK3
13	9606.ENSP00000289153	0.844	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
14	9606.ENSP00000366563	0.835	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
15	9606.ENSP00000343204	0.831	Tyrosine-protein kinase JAK1
16	9606.ENSP00000307078	0.823	Kinesin-1 heavy chain
17	9606.ENSP00000482457	0.808	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
18	9606.ENSP00000244007	0.803	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
19	9606.ENSP00000240851	0.795	Protein TFG
20	9606.ENSP00000400142	0.753	RNA-binding protein EWS

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015631	1.000	tubulin binding
GO:0043621	0.999	protein self-association
GO:0048487	0.990	beta-tubulin binding
GO:0043014	0.990	alpha-tubulin binding
GO:0008017	0.420	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.962	cellular process
GO:0065007	0.940	biological regulation
GO:0050794	0.931	regulation of cellular process
GO:0051179	0.855	localization
GO:0098813	0.843	nuclear chromosome segregation
GO:0140014	0.822	mitotic nuclear division
GO:0051234	0.816	establishment of localization
GO:0051310	0.797	metaphase plate congression
GO:0000070	0.791	mitotic sister chromatid segregation
GO:0007080	0.784	mitotic metaphase plate congression
GO:0050896	0.769	response to stimulus
GO:0008608	0.715	attachment of spindle microtubules to kinetochore
GO:0048519	0.684	negative regulation of biological process
GO:0051128	0.666	regulation of cellular component organization
GO:0048523	0.550	negative regulation of cellular process
GO:0019222	0.470	regulation of metabolic process
GO:0033043	0.415	regulation of organelle organization
GO:0048518	0.342	positive regulation of biological process
GO:0048522	0.318	positive regulation of cellular process
GO:0032501	0.310	multicellular organismal process
GO:0032502	0.307	developmental process
GO:0048856	0.304	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015630	0.995	microtubule cytoskeleton
GO:0005829	0.992	cytosol
GO:0016020	0.878	membrane
GO:0043227	0.761	membrane-bounded organelle
GO:0005819	0.536	spindle
GO:0072686	0.387	mitotic spindle
GO:0032991	0.323	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]