StarFunc result for job id Q9HC36

User Input

>input (420 residues)
MAALVRPARFVVRPLLQVVQAWDLDARRWVRALRRSPVKVVFPSGEVVEQKRAPGKQPRK
APSEASAQEQREKQPLEESASRAPSTWEESGLRYDKAYPGDRRLSSVMTIVKSRPFREKQ
GKILLEGRRLISDALKAGAVPKMFFFSRLEYLKELPVDKLKGVSLIKVKFEDIKDWSDLV
TPQGIMGIFAKPDHVKMTYPKTQLQHSLPLLLICDNLRDPGNLGTILRSAAGAGCSKVLL
TKGCVDAWEPKVLRAGMGAHFRMPIINNLEWETVPNYLPPDTRVYVADNCGLYAQAEMSN
KASDHGWVCDQRVMKFHKYEEEEDVETGASQDWLPHVEVQSYDSDWTEAPAAVVIGGETY
GVSLESLQLAESTGGKRLLIPVVPGVDSLNSAMAASILLFEGKRQLRGRAEDLSRDRSYH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HC36	1.000	1.000	7.633E-85	420	1.000	1.000	Q9HC36.pdb.gz	MRM3_HUMAN rRNA methyltransferase 3, mitochondrial OS=Homo sapiens OX=9606 GN=MRM3 PE=1 SV=2
2	AFDB:Q5ND52	0.761	0.765	2.599E-68	418	0.812	0.816	Q5ND52.pdb.gz	MRM3_MOUSE rRNA methyltransferase 3, mitochondrial OS=Mus musculus OX=10090 GN=Mrm3 PE=2 SV=1
3	PDB:7oi61	0.542	0.851	4.575E-35	257	0.602	0.984	7oi61.pdb.gz	A distinct assembly pathway of the human 39S late pre-mitoribosome.
4	AFDB:Q9F5K6	0.568	0.810	6.344E-19	287	0.150	0.220	Q9F5K6.pdb.gz	AVRB_STRVR 23S rRNA (uridine(2479)-2'-O)-methyltransferase OS=Streptomyces viridochromogenes OX=1938 GN=aviRb PE=1 SV=1
5	AFDB:P94978	0.507	0.796	8.565E-19	260	0.176	0.285	P94978.pdb.gz	P94978_MYCTU Possible 23S rRNA methyltransferase TsnR OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=tsnR PE=1 SV=2
6	PDB:1x7oA	0.521	0.794	3.833E-18	267	0.145	0.228	1x7oA.pdb.gz
7	AFDB:Q38DC9	0.494	0.365	1.831E-17	586	0.188	0.135	Q38DC9.pdb.gz	Q38DC9_TRYB2 tRNA/rRNA methyltransferase SpoU type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3800 PE=1 SV=1
8	AFDB:Q6IN84	0.466	0.546	4.412E-16	353	0.140	0.167	Q6IN84.pdb.gz	MRM1_HUMAN rRNA methyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=MRM1 PE=1 SV=1
9	AFDB:Q99J25	0.475	0.612	1.466E-15	320	0.150	0.197	Q99J25.pdb.gz	MRM1_MOUSE rRNA methyltransferase 1, mitochondrial OS=Mus musculus OX=10090 GN=Mrm1 PE=2 SV=2
10	AFDB:P25270	0.469	0.477	1.938E-14	412	0.131	0.133	P25270.pdb.gz	MRM1_YEAST rRNA methyltransferase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRM1 PE=1 SV=2
11	PDB:1gz0F	0.414	0.644	4.220E-14	253	0.138	0.229	1gz0F.pdb.gz
12	AFDB:Q8W497	0.448	0.328	9.805E-14	589	0.164	0.117	Q8W497.pdb.gz	Q8W497_ARATH rRNA methyltransferase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g19870 PE=1 SV=1
13	AFDB:Q57TV7	0.491	0.548	1.493E-13	373	0.152	0.172	Q57TV7.pdb.gz	Q57TV7_TRYB2 tRNA/rRNA methyltransferase SpoU type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.330 PE=4 SV=1
14	PDB:7edcA	0.313	0.535	2.041E-8	236	0.081	0.144	7edcA.pdb.gz	Unique substrate specificity of type II tRNA Gm18 methyltransferase from Escherichia coli
15	PDB:1v2xA	0.329	0.691	3.300E-8	191	0.107	0.236	1v2xA.pdb.gz	Deep Knot Structure for Construction of Active Site and Cofactor Binding Site of tRNA Modification Enzyme
16	PDB:4xboA	0.299	0.522	6.015E-8	228	0.076	0.140	4xboA.pdb.gz	tRNA recognition by a bacterial tRNA Xm32 modification enzyme from the SPOUT methyltransferase superfamily
17	PDB:1zjrA	0.320	0.643	6.782E-8	197	0.083	0.178	1zjrA.pdb.gz
18	PDB:4jalA	0.312	0.770	7.952E-7	156	0.081	0.218	4jalA.pdb.gz	The tRNA recognition mechanism of the minimalist SPOUT methyltransferase, TrmL
19	PDB:7d51B	0.300	0.702	1.843E-6	166	0.076	0.193	7d51B.pdb.gz
20	PDB:4e8bA	0.262	0.416	3.421E-4	242	0.071	0.124	4e8bA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5ND52	0.0	695	418	0.805	0.809	MRM3_MOUSE rRNA methyltransferase 3, mitochondrial OS=Mus musculus OX=10090 GN=Mrm3 PE=2 SV=1
2	Q9HC36	0.0	862	420	1.000	1.000	MRM3_HUMAN rRNA methyltransferase 3, mitochondrial OS=Homo sapiens OX=9606 GN=MRM3 PE=1 SV=2
3	P94978	9.72e-15	75.9	260	0.193	0.312	P94978_MYCTU Possible 23S rRNA methyltransferase TsnR OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=tsnR PE=1 SV=2
4	Q38DC9	1.50e-11	68.6	586	0.124	0.089	Q38DC9_TRYB2 tRNA/rRNA methyltransferase SpoU type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3800 PE=1 SV=1
5	Q5SM16	8.03e-06	48.5	194	0.064	0.139	TRMH_THET8 tRNA (guanosine(18)-2'-O)-methyltransferase OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=trmH PE=1 SV=1
6	Q72GI1	8.03e-06	48.5	194	0.064	0.139	TRMH_THET2 tRNA (guanosine(18)-2'-O)-methyltransferase OS=Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) OX=262724 GN=trmH PE=1 SV=1
7	O67577	2.56e-05	47.4	211	0.062	0.123	TRMH_AQUAE tRNA (guanosine(18)-2'-O)-methyltransferase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=trmH PE=1 SV=1
8	Q9F5K6	1.53e-04	45.8	287	0.105	0.153	AVRB_STRVR 23S rRNA (uridine(2479)-2'-O)-methyltransferase OS=Streptomyces viridochromogenes OX=1938 GN=aviRb PE=1 SV=1
9	P0AGJ2	5.60e-04	43.5	229	0.050	0.092	TRMH_ECOLI tRNA (guanosine(18)-2'-O)-methyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=trmH PE=1 SV=1
10	Q6IN84	6.69e-04	43.9	353	0.126	0.150	MRM1_HUMAN rRNA methyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=MRM1 PE=1 SV=1
11	P63177	0.001	42.7	243	0.124	0.214	RLMB_ECOLI 23S rRNA (guanosine-2'-O-)-methyltransferase RlmB OS=Escherichia coli (strain K12) OX=83333 GN=rlmB PE=1 SV=1
12	Q57TV7	0.019	39.3	373	0.050	0.056	Q57TV7_TRYB2 tRNA/rRNA methyltransferase SpoU type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.330 PE=4 SV=1
13	O94631	0.022	38.9	301	0.050	0.070	MRM1_SCHPO rRNA methyltransferase 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mrm1 PE=3 SV=1
14	Q99J25	0.060	37.7	320	0.117	0.153	MRM1_MOUSE rRNA methyltransferase 1, mitochondrial OS=Mus musculus OX=10090 GN=Mrm1 PE=2 SV=2
15	P25270	0.073	37.7	412	0.045	0.046	MRM1_YEAST rRNA methyltransferase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRM1 PE=1 SV=2
16	Q17392	1.2	33.9	840	0.086	0.043	CUL4_CAEEL Cullin-4 OS=Caenorhabditis elegans OX=6239 GN=cul-4 PE=1 SV=3
17	P13607	1.6	33.5	1041	0.040	0.016	ATNA_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster OX=7227 GN=Atpalpha PE=1 SV=3
18	Q9UNF0	2.4	32.7	486	0.076	0.066	PACN2_HUMAN Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens OX=9606 GN=PACSIN2 PE=1 SV=2
19	A0A0U1RR22	3.0	32.7	451	0.076	0.071	A0A0U1RR22_HUMAN Protein kinase C and casein kinase substrate in neurons 2 (Fragment) OS=Homo sapiens OX=9606 GN=PACSIN2 PE=1 SV=1
20	A0A087WZC1	3.8	31.2	158	0.060	0.158	A0A087WZC1_HUMAN Mitochondrial rRNA methyltransferase 1 OS=Homo sapiens OX=9606 GN=MRM1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11871 DUF3391	4.4e+02	12.8	Domain of unknown function (DUF3391)
2	PF00588 SpoU_methylase	2.9e-18	77.8	SpoU rRNA Methylase family
3	PF08032 SpoU_sub_bind	9.4	17.9	RNA 2'-O ribose methyltransferase substrate binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306080

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000481559	0.839	rRNA methyltransferase 1, mitochondrial
2	9606.ENSP00000298317	0.833	Mitochondrial RNA pseudouridine synthase RPUSD4
3	9606.ENSP00000417602	0.820	Belongs to the universal ribosomal protein uL29 family.
4	9606.ENSP00000242257	0.806	rRNA methyltransferase 2, mitochondrial
5	9606.ENSP00000419740	0.789	5-methylcytosine rRNA methyltransferase NSUN4
6	9606.ENSP00000419370	0.771	Mitochondrial assembly of ribosomal large subunit protein 1
7	9606.ENSP00000254799	0.769	G-rich sequence factor 1
8	9606.ENSP00000302801	0.735	tRNA (adenine(58)-N(1))-methyltransferase, mitochondrial
9	9606.ENSP00000480378	0.735	Transcription termination factor 4, mitochondrial
10	9606.ENSP00000301585	0.734	Peptidyl-tRNA hydrolase ICT1, mitochondrial
11	9606.ENSP00000323047	0.700	Mitochondrial ribosome-associated GTPase 1
12	9606.ENSP00000424328	0.694	Mitochondrial ribosomal protein S30
13	9606.ENSP00000356134	0.693	Dimethyladenosine transferase 1, mitochondrial
14	9606.ENSP00000199706	0.688	Mitochondrial ribosomal protein L28
15	9606.ENSP00000264230	0.681	Nitric oxide-associated protein 1
16	9606.ENSP00000287025	0.668	Transcription termination factor 3, mitochondrial
17	9606.ENSP00000305682	0.661	Mitochondrial ribosomal protein L39
18	9606.ENSP00000254630	0.652	Pentatricopeptide repeat domain-containing protein 3, mitochondrial
19	9606.ENSP00000225698	0.646	Complement component 1 Q subcomponent-binding protein, mitochondrial
20	9606.ENSP00000332340	0.646	Probable ATP-dependent RNA helicase DDX28

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0003723	1.000	RNA binding
GO:0070039	1.000	rRNA (guanosine-2'-O-)-methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0044238	0.994	primary metabolic process
GO:0043170	0.990	macromolecule metabolic process
GO:0034641	0.988	cellular nitrogen compound metabolic process
GO:1901360	0.981	organic cyclic compound metabolic process
GO:0046483	0.980	heterocycle metabolic process
GO:0006725	0.980	cellular aromatic compound metabolic process
GO:0006139	0.967	nucleobase-containing compound metabolic process
GO:0042254	0.964	ribosome biogenesis
GO:0006364	0.949	rRNA processing
GO:0031167	0.917	rRNA methylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.995	intracellular organelle lumen
GO:0005759	0.852	mitochondrial matrix
GO:0043232	0.477	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:58956	1.000	a ribonucleotide in RNA + S-adenosyl-L-methionine = a 2'-O-methylribonucleotide in RNA + H(+) + S-adenosyl-L-homocysteine

[back to server]