StarFunc result for job id Q9HC56

User Input

>input (1237 residues)
MDLRDFYLLAALIACLRLDSAIAQELIYTIREELPENVPIGNIPKDLNISHINAATGTSA
SLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPN
DFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYE
LLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQV
TVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATK
RLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDL
RYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYL
LETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSE
NNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIF
TVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDAD
AGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAK
VTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSG
NNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKSLHTLVLVFLYVNDTAGN
ASYIYDLIRRTMETPLDRNIGDSSQPYQNEDYLTIMIAIIAGAMVVIVVIFVTVLVRCRH
ASRFKAAQRSKQGAEWMSPNQENKQNKKKKRKKRKSPKSSLLNFVTIEESKPDDAVHEPI
NGTISLPAELEEQSIGRFDWGPAPPTTFKPNSPDLAKHYKSASPQPAFHLKPDTPVSVKK
HHVIQELPLDNTFVGGCDTLSKRSSTSSDHFSASECSSQGGFKTKGPLHTRQCNSHSKSD
NIPVTPQKCPSSTGFHIQENEESHYESQRRVTFHLPDGSQESCSDSGLGDHEPVGSGTLI
SHPLPLVQPQDEFYDQASPDKRTEADGNSDPNSDGPLGPRGLAEATEMCTQECLVLGHSD
NCWMPPGLGPYQHPKSPLSTFAPQKEWVKKDKLVNGHTLTRAWKEDSNRNQFNDRKQYGS
NEGHFNNGSHMTDIPLANLKSYKQAGGATESPKEHQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0A6YWY8	0.589	0.605	0.000	1203	0.960	0.988	A0A0A6YWY8.pdb.gz	A0A0A6YWY8_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
2	AFDB:A0A0A6YY83	0.574	0.566	0.000	1255	0.392	0.386	A0A0A6YY83.pdb.gz	A0A0A6YY83_MOUSE Protocadherin 7 OS=Mus musculus OX=10090 GN=Pcdh7 PE=1 SV=1
3	AFDB:B2RXR7	0.589	0.625	0.000	1161	0.925	0.985	B2RXR7.pdb.gz	B2RXR7_MOUSE Pcdh9 protein OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
4	AFDB:B2RY69	0.586	0.586	0.000	1237	0.981	0.981	B2RY69.pdb.gz	B2RY69_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
5	AFDB:Q9BZA7	0.517	0.478	0.000	1347	0.538	0.494	Q9BZA7.pdb.gz	PC11X_HUMAN Protocadherin-11 X-linked OS=Homo sapiens OX=9606 GN=PCDH11X PE=2 SV=1
6	AFDB:Q9BZA8	0.567	0.528	0.000	1340	0.533	0.492	Q9BZA8.pdb.gz	PC11Y_HUMAN Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1
7	AFDB:Q8N6Y1	0.328	0.419	2.823E-97	951	0.300	0.390	Q8N6Y1.pdb.gz	PCD20_HUMAN Protocadherin-20 OS=Homo sapiens OX=9606 GN=PCDH20 PE=2 SV=2
8	AFDB:Q96QU1	0.153	0.100	2.209E-55	1955	0.217	0.137	Q96QU1.pdb.gz	PCD15_HUMAN Protocadherin-15 OS=Homo sapiens OX=9606 GN=PCDH15 PE=1 SV=2
9	AFDB:Q9VGW1	0.247	0.169	2.344E-47	1943	0.209	0.133	Q9VGW1.pdb.gz	CAD86_DROME Cadherin-86C OS=Drosophila melanogaster OX=7227 GN=Cad86C PE=2 SV=3
10	AFDB:D3ZB51	0.130	0.123	1.580E-25	1328	0.159	0.148	D3ZB51.pdb.gz	TUTLB_RAT Protein turtle homolog B OS=Rattus norvegicus OX=10116 GN=Igsf9b PE=1 SV=1
11	PDB:4aq1A	0.093	0.145	8.982E-15	721	0.068	0.117	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
12	PDB:1e07A	0.131	0.196	1.100E-14	642	0.065	0.126	1e07A.pdb.gz
13	PDB:6velC	0.144	0.779	2.024E-14	209	0.049	0.287	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
14	PDB:5oj2B	0.107	0.165	3.655E-13	692	0.078	0.140	5oj2B.pdb.gz
15	PDB:7nycA	0.076	0.064	7.179E-11	1542	0.072	0.058	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
16	PDB:5a42A	0.070	0.057	1.233E-9	1597	0.074	0.058	5a42A.pdb.gz
17	PDB:6h03A	0.081	0.082	3.580E-9	1223	0.082	0.083	6h03A.pdb.gz
18	PDB:4ziqA	0.070	0.062	7.287E-9	1450	0.080	0.068	4ziqA.pdb.gz
19	PDB:7q5zA	0.068	0.064	8.485E-9	1344	0.075	0.069	7q5zA.pdb.gz
20	PDB:7vonA	0.077	0.071	4.308E-8	1399	0.072	0.064	7vonA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087X2C4	651	1269	0.345	0.336	A0A087X2C4_HUMAN Protocadherin 7 OS=Homo sapiens OX=9606 GN=PCDH7 PE=1 SV=2
2	A0A0A6YWK0	1181	1026	0.483	0.582	A0A0A6YWK0_MOUSE Protocadherin 11 X-linked OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1
3	A0A0A6YWM0	1762	873	0.699	0.991	A0A0A6YWM0_MOUSE Protocadherin 9 (Fragment) OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
4	A0A0A6YWY8	2438	1203	0.960	0.988	A0A0A6YWY8_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
5	A0A0A6YY09	2345	1195	0.948	0.982	A0A0A6YY09_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
6	A0A0A6YY37	1788	1038	0.711	0.847	A0A0A6YY37_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
7	A0A0A6YY83	638	1255	0.340	0.335	A0A0A6YY83_MOUSE Protocadherin 7 OS=Mus musculus OX=10090 GN=Pcdh7 PE=1 SV=1
8	A0A8I5ZK96	2519	1237	0.985	0.985	A0A8I5ZK96_RAT Protocadherin 9 OS=Rattus norvegicus OX=10116 GN=Pcdh9 PE=4 SV=1
9	A0JNT1	1263	1128	0.524	0.574	A0JNT1_MOUSE Pcdh11x protein OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1
10	A2RS43	593	1069	0.289	0.335	A2RS43_MOUSE Protocadherin 7 OS=Mus musculus OX=10090 GN=Pcdh7 PE=1 SV=1
11	B1AZR7	1301	1320	0.538	0.505	B1AZR7_MOUSE Protocadherin 11 X-linked OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1
12	B2RXR7	2043	1161	0.810	0.863	B2RXR7_MOUSE Pcdh9 protein OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
13	B2RY66	2434	1203	0.960	0.987	B2RY66_MOUSE Pcdh9 protein OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
14	B2RY69	2507	1237	0.981	0.981	B2RY69_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
15	B5AK95	652	553	0.260	0.582	B5AK95_MOUSE Protocadherin X-linked 11 (Fragment) OS=Mus musculus OX=10090 GN=Pcdh11x PE=2 SV=1
16	E9Q2S0	638	1247	0.344	0.342	E9Q2S0_MOUSE Protocadherin 7 OS=Mus musculus OX=10090 GN=Pcdh7 PE=1 SV=2
17	E9Q622	1342	1334	0.550	0.510	E9Q622_MOUSE Protocadherin 11 X-linked OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1
18	F1LS01	2441	1203	0.962	0.989	F1LS01_RAT Protocadherin 9 OS=Rattus norvegicus OX=10116 GN=Pcdh9 PE=4 SV=4
19	F6ZNL5	1296	1338	0.542	0.501	F6ZNL5_MOUSE Protocadherin 11 X-linked OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1
20	F7BJK1	655	1077	0.349	0.401	F7BJK1_MOUSE Protocadherin 1 (Fragment) OS=Mus musculus OX=10090 GN=Pcdh1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17963 Big_9	46	16.1	Bacterial Ig domain
2	PF00028 Cadherin	5.9e-99	336.1	Cadherin domain
3	PF08266 Cadherin_2	5.4e-16	69.5	Cadherin-like
4	PF16184 Cadherin_3	5.6e-05	34.4	Cadherin-like
5	PF17803 Cadherin_4	2.3	20.2	Bacterial cadherin-like domain
6	PF16118 DUF4834	9.5e+02	12.2	Domain of unknown function (DUF4834)
7	PF14575 EphA2_TM	2.5e+02	13.8	Ephrin type-A receptor 2 transmembrane domain
8	PF09134 Invasin_D3	1.2e+02	14.6	Invasin, domain 3
9	PF08374 Protocadherin	3.9e-80	280.5	Protocadherin
10	PF17756 RET_CLD1	26	16.6	RET Cadherin like domain 1
11	PF01496 V_ATPase_I	1.3e+02	11.9	V-type ATPase 116kDa subunit family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367096

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264047	0.697	High affinity choline transporter 1
2	9606.ENSP00000386942	0.687	Beta-galactoside alpha-2,6-sialyltransferase 2
3	9606.ENSP00000382163	0.672	Belongs to the class V-like SAM-binding methyltransferase superfamily. SETD4 family
4	9606.ENSP00000380692	0.660	Lysine-specific demethylase 7A
5	9606.ENSP00000365694	0.651	Serine/threonine-protein phosphatase 1 regulatory subunit 10
6	9606.ENSP00000300305	0.649	Runt-related transcription factor 1
7	9606.ENSP00000242839	0.647	Copper-transporting ATPase 2
8	9606.ENSP00000308318	0.642	Protein phosphatase 1 regulatory subunit 3B
9	9606.ENSP00000360035	0.605	Protein phosphatase 1 regulatory subunit 3D
10	9606.ENSP00000321498	0.594	Sugar phosphate exchanger 3
11	9606.ENSP00000382004	0.548	Catenin delta-1
12	9606.ENSP00000311677	0.543	Nuclear inhibitor of protein phosphatase 1
13	9606.ENSP00000468312	0.539	Echinoderm microtubule-associated protein-like 2
14	9606.ENSP00000385142	0.526	Neurexin-1
15	9606.ENSP00000368793	0.522	Peptide chain release factor 1, mitochondrial
16	9606.ENSP00000367001	0.511	Dipeptidyl aminopeptidase-like protein 6
17	9606.ENSP00000368612	0.506	Von Willebrand factor A domain-containing protein 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048731	0.996	system development
GO:0007420	0.987	brain development
GO:0030900	0.942	forebrain development
GO:0009987	0.639	cellular process
GO:0065007	0.539	biological regulation
GO:0050789	0.508	regulation of biological process
GO:0050794	0.455	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0030054	0.994	cell junction
GO:0120025	0.975	plasma membrane bounded cell projection
GO:0005911	0.969	cell-cell junction
GO:0043005	0.967	neuron projection
GO:0044291	0.961	cell-cell contact zone
GO:0030426	0.959	growth cone
GO:0016020	0.510	membrane
GO:0005622	0.314	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]