StarFunc result for job id Q9HC57

User Input

>input (220 residues)
MPLTGVGPGSCRRQIIRALCLLLLLLHAGSAKNIWKRALPARLAEKSRAEEAGAPGGPRQ
PRADRCPPPPRTLPPGACQAARCQADSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQP
KPRWLGGNGWLLDGPEEVLQAEACSTTEDGAEPLLCPSGYECHILSPGDVAEGIPNRGQC
VKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHFQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O70280	0.358	0.371	1.084E-29	212	0.782	0.811	O70280.pdb.gz	WFDC1_RAT WAP four-disulfide core domain protein 1 OS=Rattus norvegicus OX=10116 GN=Wfdc1 PE=1 SV=1
2	AFDB:A0A0B5JQ43	0.316	0.316	1.053E-21	220	0.550	0.550	A0A0B5JQ43.pdb.gz
3	AFDB:Q58WW2	0.118	0.041	1.579	860	0.091	0.023	Q58WW2.pdb.gz	DCAF6_HUMAN DDB1- and CUL4-associated factor 6 OS=Homo sapiens OX=9606 GN=DCAF6 PE=1 SV=1
4	AFDB:Q8AV57	0.113	0.016	2.278	2177	0.155	0.016	Q8AV57.pdb.gz	SDK2_CHICK Protein sidekick-2 OS=Gallus gallus OX=9031 GN=SDK2 PE=1 SV=2
5	PDB:6edtJ	0.084	0.142	2.447	109	0.045	0.092	6edtJ.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
6	PDB:7qi41	0.083	0.185	2.601	56	0.023	0.089	7qi41.pdb.gz	Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
7	AFDB:Q9W1H0	0.118	0.026	3.287	1482	0.150	0.022	Q9W1H0.pdb.gz	Q9W1H0_DROME HL01030p OS=Drosophila melanogaster OX=7227 GN=Lpt PE=1 SV=2
8	PDB:6hivA6	0.094	0.183	3.530	72	0.027	0.083	6hivA6.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
9	AFDB:A6XLD8	0.146	0.038	4.461	1105	0.141	0.028	A6XLD8.pdb.gz	A6XLD8_DANRE Sterol regulatory element binding transcription factor 1 OS=Danio rerio OX=7955 GN=SREBF1 PE=2 SV=1
10	AFDB:Q9P6K0	0.070	0.037	4.461	475	0.145	0.067	Q9P6K0.pdb.gz	YLA3_SCHPO Uncharacterized HTH La-type RNA-binding protein C1527.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1527.03 PE=1 SV=1
11	PDB:4lecA	0.101	0.110	4.508	202	0.014	0.015	4lecA.pdb.gz	The Crystal Structure of Human Methyltransferase-Like Protein 21A in Complex with SAH
12	AFDB:Q2EY15	0.100	0.028	4.743	1191	0.132	0.024	Q2EY15.pdb.gz	PRTG_MOUSE Protogenin OS=Mus musculus OX=10090 GN=Prtg PE=2 SV=1
13	AFDB:Q700D7	0.131	0.063	4.743	499	0.164	0.072	Q700D7.pdb.gz	Q700D7_ARATH At4g12670 OS=Arabidopsis thaliana OX=3702 GN=At4g12670 PE=1 SV=1
14	AFDB:Q91W69	0.130	0.054	5.359	636	0.182	0.063	Q91W69.pdb.gz	EPN3_MOUSE Epsin-3 OS=Mus musculus OX=10090 GN=Epn3 PE=1 SV=1
15	PDB:1frgL	0.092	0.093	5.756	217	0.027	0.028	1frgL.pdb.gz	Crystal structure of a peptide complex of anti-influenza peptide antibody Fab 26/9. Comparison of two different antibodies bound to the same peptide antigen.
16	PDB:3j6bX	0.118	0.235	6.504	64	0.041	0.141	3j6bX.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
17	PDB:5viyI	0.090	0.092	6.504	213	0.018	0.019	5viyI.pdb.gz	Asymmetric recognition of HIV-1 Envelope trimer by V1V2 loop-targeting antibodies.
18	PDB:2k8pA	0.082	0.091	6.913	189	0.105	0.122	2k8pA.pdb.gz
19	PDB:3k57A	0.086	0.029	7.349	782	0.023	0.006	3k57A.pdb.gz	Structural insight into translesion synthesis by DNA Pol II
20	PDB:6c0fs	0.117	0.153	7.349	157	0.086	0.121	6c0fs.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9ESH5	5.47e-109	313	211	0.745	0.777	WFDC1_MOUSE WAP four-disulfide core domain protein 1 OS=Mus musculus OX=10090 GN=Wfdc1 PE=2 SV=1
2	O70280	3.12e-107	309	212	0.782	0.811	WFDC1_RAT WAP four-disulfide core domain protein 1 OS=Rattus norvegicus OX=10116 GN=Wfdc1 PE=1 SV=1
3	Q9IAR4	0.046	37.0	652	0.073	0.025	Q9IAR4_DANRE Anosmin-1 OS=Danio rerio OX=7955 GN=wu:fl91z45 PE=2 SV=1
4	G5EDX1	0.17	35.0	700	0.082	0.026	G5EDX1_CAEEL WAP-type 'four-disulfide core OS=Caenorhabditis elegans OX=6239 GN=kal-1 PE=4 SV=1
5	P23352	0.21	35.0	680	0.064	0.021	KALM_HUMAN Anosmin-1 OS=Homo sapiens OX=9606 GN=ANOS1 PE=1 SV=3
6	M0RCZ7	0.56	32.3	131	0.059	0.099	M0RCZ7_RAT Secretory leukocyte peptidase inhibitor OS=Rattus norvegicus OX=10116 GN=Slpi PE=4 SV=2
7	Q1MT36	0.66	33.5	633	0.105	0.036	Q1MT36_DANRE Anosmin 1b OS=Danio rerio OX=7955 GN=anosmin-1b PE=4 SV=1
8	A0A096MJ68	0.95	31.2	107	0.059	0.121	A0A096MJ68_RAT Secretory leukocyte peptidase inhibitor OS=Rattus norvegicus OX=10116 GN=Slpi PE=4 SV=2
9	P03973	1.4	31.2	132	0.059	0.098	SLPI_HUMAN Antileukoproteinase OS=Homo sapiens OX=9606 GN=SLPI PE=1 SV=2
10	P19957	1.6	30.8	117	0.045	0.085	ELAF_HUMAN Elafin OS=Homo sapiens OX=9606 GN=PI3 PE=1 SV=3
11	F1R4S7	1.8	31.6	225	0.136	0.133	F1R4S7_DANRE GTP:AMP phosphotransferase AK3, mitochondrial OS=Danio rerio OX=7955 GN=ak3l1 PE=1 SV=1
12	Q9WUQ4	2.5	30.4	130	0.055	0.092	Q9WUQ4_RAT Secretory leukocyte protease inhibitor OS=Rattus norvegicus OX=10116 GN=Slpi PE=2 SV=1
13	P97430	2.6	30.4	131	0.055	0.092	SLPI_MOUSE Antileukoproteinase OS=Mus musculus OX=10090 GN=Slpi PE=1 SV=1
14	Q9VCC7	3.3	31.2	525	0.077	0.032	Q9VCC7_DROME FI03681p OS=Drosophila melanogaster OX=7227 GN=Kal1 PE=2 SV=2
15	Q14508	4.4	29.6	124	0.050	0.089	WFDC2_HUMAN WAP four-disulfide core domain protein 2 OS=Homo sapiens OX=9606 GN=WFDC2 PE=1 SV=2
16	Q5SSJ1	4.8	28.5	76	0.041	0.118	Q5SSJ1_MOUSE Activated macrophage/microglia WAP domain protein OS=Mus musculus OX=10090 GN=Wfdc17 PE=1 SV=1
17	Q8TCV5	6.6	29.6	224	0.055	0.054	WFDC5_HUMAN WAP four-disulfide core domain protein 5 OS=Homo sapiens OX=9606 GN=WFDC5 PE=1 SV=1
18	B0F481	7.1	30.0	833	0.073	0.019	BIODA_ARATH Bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=BIO3-BIO1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00095 WAP	0.0039	28.9	WAP-type (Whey Acidic Protein) 'four-disulfide core'

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000219454

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000243346	0.677	N-myc-interactor
2	9606.ENSP00000361875	0.659	WAP four-disulfide core domain protein 5
3	9606.ENSP00000362201	0.658	Testican-2
4	9606.ENSP00000274276	0.577	Oncostatin-M-specific receptor subunit beta
5	9606.ENSP00000270583	0.561	Kelch domain containing 4
6	9606.ENSP00000269346	0.545	Protein tweety homolog 2
7	9606.ENSP00000342082	0.541	Antileukoproteinase
8	9606.ENSP00000243924	0.532	Elafin
9	9606.ENSP00000346478	0.516	ADAMTS-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.320	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.977	regulation of cellular process
GO:0048583	0.972	regulation of response to stimulus
GO:0048519	0.970	negative regulation of biological process
GO:0048523	0.861	negative regulation of cellular process
GO:0042127	0.834	regulation of cell population proliferation
GO:0050896	0.823	response to stimulus
GO:0048585	0.787	negative regulation of response to stimulus
GO:0080134	0.771	regulation of response to stress
GO:0032101	0.764	regulation of response to external stimulus
GO:0009987	0.594	cellular process
GO:1903034	0.489	regulation of response to wounding
GO:0008285	0.436	negative regulation of cell population proliferation
GO:0048518	0.429	positive regulation of biological process
GO:0048522	0.364	positive regulation of cellular process
GO:0031347	0.361	regulation of defense response
GO:0032102	0.361	negative regulation of response to external stimulus
GO:0009966	0.343	regulation of signal transduction
GO:0051128	0.324	regulation of cellular component organization
GO:0010033	0.305	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0005622	0.459	intracellular anatomical structure
GO:0043231	0.430	intracellular membrane-bounded organelle
GO:0070013	0.426	intracellular organelle lumen
GO:0005737	0.423	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]