StarFunc result for job id Q9HC62

User Input

>input (589 residues)
MYRWLVRILGTIFRFCDRSVPPARALLKRRRSDSTLFSTVDTDEIPAKRPRLDCFIHQVK
NSLYNAASLFGFPFQLTTKPMVTSACNGTRNVAPSGEVFSNSSSCELTGSGSWNNMLKLG
NKSPNGISDYPKIRVTVTRDQPRRVLPSFGFTLNSEGCNRRPGGRRHSKGNPESSLMWKP
QEQAVTEMISEESGKGLRRPHCTVEEGVQKEEREKYRKLLERLKESGHGNSVCPVTSNYH
SSQRSQMDTLKTKGWGEEQNHGVKTTQFVPKQYRLVETRGPLCSLRSEKRCSKGKITDTE
TMVGIRFENESRRGYQLEPDLSEEVSARLRLGSGSNGLLRRKVSIIETKEKNCSGKERDR
RTDDLLELTEDMEKEISNALGHGPQDEILSSAFKLRITRGDIQTLKNYHWLNDEVINFYM
NLLVERNKKQGYPALHVFSTFFYPKLKSGGYQAVKRWTKGVNLFEQEIILVPIHRKVHWS
LVVIDLRKKCLKYLDSMGQKGHRICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIP
QQLNGSDCGMFTCKYADYISRDKPITFTQHQMPLFRKKMVWEILHQQLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HC62	1.000	1.000	1.498E-90	589	1.000	1.000	Q9HC62.pdb.gz	SENP2_HUMAN Sentrin-specific protease 2 OS=Homo sapiens OX=9606 GN=SENP2 PE=1 SV=3
2	AFDB:Q91ZX6	0.518	0.519	1.913E-78	588	0.878	0.879	Q91ZX6.pdb.gz	SENP2_MOUSE Sentrin-specific protease 2 OS=Mus musculus OX=10090 GN=Senp2 PE=1 SV=2
3	AFDB:Q9P0U3	0.407	0.373	4.189E-34	644	0.348	0.318	Q9P0U3.pdb.gz	SENP1_HUMAN Sentrin-specific protease 1 OS=Homo sapiens OX=9606 GN=SENP1 PE=1 SV=2
4	PDB:2bkrA	0.291	0.751	2.818E-9	211	0.059	0.166	2bkrA.pdb.gz
5	AFDB:Q9BQF6	0.296	0.170	1.026E-7	1050	0.217	0.122	Q9BQF6.pdb.gz	SENP7_HUMAN Sentrin-specific protease 7 OS=Homo sapiens OX=9606 GN=SENP7 PE=1 SV=4
6	PDB:5hafB	0.226	0.368	1.752E-4	327	0.059	0.107	5hafB.pdb.gz
7	PDB:5io3A	0.200	0.282	8.478E-4	385	0.046	0.070	5io3A.pdb.gz
8	PDB:1avpA	0.149	0.353	3.666E-3	204	0.042	0.123	1avpA.pdb.gz	Crystal structure of the human adenovirus proteinase with its 11 amino acid cofactor.
9	AFDB:O17087	0.083	0.053	2.216E-1	1113	0.131	0.069	O17087.pdb.gz	GLD2_CAEEL Poly(A) RNA polymerase gld-2 OS=Caenorhabditis elegans OX=6239 GN=gld-2 PE=1 SV=2
10	AFDB:O64843	0.093	0.096	4.117E-1	567	0.122	0.127	O64843.pdb.gz	CID7_ARATH Polyadenylate-binding protein-interacting protein 7 OS=Arabidopsis thaliana OX=3702 GN=CID7 PE=1 SV=1
11	PDB:7mq8SM	0.070	0.124	4.650E-1	290	0.066	0.134	7mq8SM.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	AFDB:A0A286YBL8	0.086	0.057	6.460E-1	1204	0.131	0.064	A0A286YBL8.pdb.gz	A0A286YBL8_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=ptpn21 PE=3 SV=1
13	AFDB:Q9V9N5	0.074	0.062	6.835E-1	778	0.143	0.108	Q9V9N5.pdb.gz	Q9V9N5_DROME Uncharacterized protein, isoform H OS=Drosophila melanogaster OX=7227 GN=Dmel\CG42748 PE=1 SV=2
14	PDB:3cpeA	0.082	0.086	7.720E-1	553	0.027	0.029	3cpeA.pdb.gz
15	PDB:3d2rB	0.067	0.100	8.640E-1	362	0.024	0.039	3d2rB.pdb.gz	Pyruvate Dehydrogenase Kinase-4 Structures Reveal a Metastable Open Conformation Fostering Robust Core-free Basal Activity.
16	PDB:5htkA	0.108	0.139	1.082	425	0.032	0.045	5htkA.pdb.gz	Crystal structure of heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB2) and the inhibitory influence of citrate on substrate binding.
17	AFDB:P13185	0.063	0.040	1.135	1064	0.100	0.055	P13185.pdb.gz	KIN1_YEAST Serine/threonine protein kinase KIN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KIN1 PE=1 SV=3
18	PDB:7obeA	0.075	0.084	1.211	480	0.063	0.077	7obeA.pdb.gz	Conformational Change of Tetratricopeptide Repeats Region Triggers Activation of Phytochrome-Associated Protein Phosphatase 5.
19	AFDB:D3ZFT1	0.070	0.045	1.270	1131	0.087	0.045	D3ZFT1.pdb.gz	D3ZFT1_RAT Replication factor C subunit 1 OS=Rattus norvegicus OX=10116 GN=Rfc1 PE=1 SV=3
20	PDB:3crlB	0.066	0.095	1.281	383	0.025	0.039	3crlB.pdb.gz	Structural and functional insights into the molecular mechanisms responsible for the regulation of pyruvate dehydrogenase kinase 2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q91ZX6	0.0	1078	588	0.881	0.883	SENP2_MOUSE Sentrin-specific protease 2 OS=Mus musculus OX=10090 GN=Senp2 PE=1 SV=2
2	Q9EQE1	0.0	1042	588	0.871	0.872	SENP2_RAT Sentrin-specific protease 2 OS=Rattus norvegicus OX=10116 GN=Senp2 PE=1 SV=1
3	Q9HC62	0.0	1226	589	1.000	1.000	SENP2_HUMAN Sentrin-specific protease 2 OS=Homo sapiens OX=9606 GN=SENP2 PE=1 SV=3
4	Q6IE23	8.11e-128	385	475	0.368	0.457	Q6IE23_RAT Sentrin/SUMO-specific protease 17 OS=Rattus norvegicus OX=10116 GN=Senp17 PE=2 SV=1
5	Q9P0U3	4.84e-95	306	644	0.246	0.225	SENP1_HUMAN Sentrin-specific protease 1 OS=Homo sapiens OX=9606 GN=SENP1 PE=1 SV=2
6	P59110	6.28e-95	305	640	0.233	0.214	SENP1_MOUSE Sentrin-specific protease 1 OS=Mus musculus OX=10090 GN=Senp1 PE=1 SV=1
7	Q09353	3.89e-56	203	697	0.180	0.152	SENP_CAEEL Sentrin-specific protease OS=Caenorhabditis elegans OX=6239 GN=ulp-1 PE=2 SV=3
8	Q7KMN4	5.09e-49	182	674	0.148	0.129	Q7KMN4_DROME BcDNA.GH02751 OS=Drosophila melanogaster OX=7227 GN=Ulp1 PE=2 SV=1
9	Q9VWK5	9.61e-48	182	1513	0.146	0.057	Q9VWK5_DROME GH15225p OS=Drosophila melanogaster OX=7227 GN=Ulp1 PE=1 SV=1
10	O42957	1.61e-42	163	568	0.136	0.141	ULP1_SCHPO Ubiquitin-like-specific protease 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ulp1 PE=3 SV=1
11	Q94F30	1.22e-40	156	489	0.154	0.186	ESD4_ARATH Ubiquitin-like-specific protease ESD4 OS=Arabidopsis thaliana OX=3702 GN=ESD4 PE=1 SV=1
12	Q8GYL3	2.21e-38	150	502	0.136	0.159	ULP1A_ARATH Ubiquitin-like-specific protease 1A OS=Arabidopsis thaliana OX=3702 GN=ULP1A PE=2 SV=2
13	A0A1D8PSK4	9.76e-38	148	491	0.138	0.165	A0A1D8PSK4_CANAL SUMO protease OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ULP2 PE=3 SV=1
14	Q9H4L4	1.04e-37	149	574	0.131	0.134	SENP3_HUMAN Sentrin-specific protease 3 OS=Homo sapiens OX=9606 GN=SENP3 PE=1 SV=2
15	Q9EP97	1.55e-37	149	568	0.129	0.134	SENP3_MOUSE Sentrin-specific protease 3 OS=Mus musculus OX=10090 GN=Senp3 PE=1 SV=1
16	Q96HI0	1.23e-34	142	755	0.146	0.114	SENP5_HUMAN Sentrin-specific protease 5 OS=Homo sapiens OX=9606 GN=SENP5 PE=1 SV=3
17	Q5B9U1	2.35e-31	132	965	0.121	0.074	Q5B9U1_EMENI Nuclear pore complex subunit Nup133, putative (AFU_orthologue AFUA_5G14040) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02689 PE=3 SV=1
18	Q02724	5.21e-24	108	621	0.117	0.111	ULP1_YEAST Ubiquitin-like-specific protease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ULP1 PE=1 SV=1
19	J3QL36	1.98e-22	98.6	237	0.107	0.266	J3QL36_HUMAN SUMO specific peptidase 3 (Fragment) OS=Homo sapiens OX=9606 GN=SENP3 PE=1 SV=1
20	Q2PS26	5.02e-17	86.7	584	0.102	0.103	ULP1D_ARATH Ubiquitin-like-specific protease 1D OS=Arabidopsis thaliana OX=3702 GN=ULP1D PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02902 Peptidase_C48	1.5e-36	137.9	Ulp1 protease family, C-terminal catalytic domain
2	PF03290 Peptidase_C57	80	13.4	Vaccinia virus I7 processing peptidase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296257

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376077	0.999	Small ubiquitin-related modifier 1
2	9606.ENSP00000405965	0.998	Small ubiquitin-related modifier 2
3	9606.ENSP00000409666	0.996	Small ubiquitin-like modifier 3
4	9606.ENSP00000401470	0.979	Ran GTPase-activating protein 1
5	9606.ENSP00000444029	0.972	Nuclear pore complex protein Nup153
6	9606.ENSP00000316054	0.820	Segment polarity protein dishevelled homolog DVL-3
7	9606.ENSP00000368169	0.815	Segment polarity protein dishevelled homolog DVL-1
8	9606.ENSP00000005340	0.802	Segment polarity protein dishevelled homolog DVL-2
9	9606.ENSP00000290158	0.718	Importin subunit beta-1
10	9606.ENSP00000381214	0.664	RANBP2-like and GRIP domain-containing protein 2
11	9606.ENSP00000296328	0.625	UBX domain-containing protein 7
12	9606.ENSP00000334373	0.576	Importin subunit alpha-3
13	9606.ENSP00000377655	0.573	Sentrin-specific protease 7
14	9606.ENSP00000402527	0.566	Sentrin-specific protease 6
15	9606.ENSP00000300087	0.562	Dynactin subunit 5
16	9606.ENSP00000261667	0.560	Importin subunit alpha-4
17	9606.ENSP00000343701	0.560	Importin subunit alpha-5
18	9606.ENSP00000438483	0.560	Importin subunit alpha-1
19	9606.ENSP00000261396	0.553	Nuclear pore complex protein Nup133
20	9606.ENSP00000348056	0.531	SUMO-conjugating enzyme UBC9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019783	1.000	ubiquitin-like protein peptidase activity
GO:0004197	0.998	cysteine-type endopeptidase activity
GO:0070139	0.734	SUMO-specific endopeptidase activity
GO:0016929	0.385	deSUMOylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.991	regulation of biological process
GO:0071704	0.987	organic substance metabolic process
GO:0044238	0.985	primary metabolic process
GO:0019222	0.981	regulation of metabolic process
GO:0060255	0.974	regulation of macromolecule metabolic process
GO:0051171	0.973	regulation of nitrogen compound metabolic process
GO:0009893	0.972	positive regulation of metabolic process
GO:0070647	0.971	protein modification by small protein conjugation or removal
GO:0050794	0.967	regulation of cellular process
GO:0080090	0.965	regulation of primary metabolic process
GO:0018205	0.965	peptidyl-lysine modification
GO:0051173	0.952	positive regulation of nitrogen compound metabolic process
GO:0010604	0.949	positive regulation of macromolecule metabolic process
GO:0051246	0.879	regulation of protein metabolic process
GO:0070646	0.818	protein modification by small protein removal
GO:0031399	0.796	regulation of protein modification process
GO:0031323	0.724	regulation of cellular metabolic process
GO:0051247	0.698	positive regulation of protein metabolic process
GO:0009987	0.641	cellular process
GO:0048519	0.625	negative regulation of biological process
GO:0048522	0.608	positive regulation of cellular process
GO:0031325	0.551	positive regulation of cellular metabolic process
GO:0032446	0.525	protein modification by small protein conjugation
GO:0016925	0.516	protein sumoylation
GO:0065009	0.510	regulation of molecular function
GO:0010605	0.328	negative regulation of macromolecule metabolic process
GO:0032502	0.313	developmental process
GO:0019219	0.313	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.305	regulation of biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0012505	0.996	endomembrane system
GO:0032991	0.979	protein-containing complex
GO:0005737	0.971	cytoplasm
GO:0005829	0.962	cytosol
GO:0140513	0.932	nuclear protein-containing complex
GO:0031967	0.893	organelle envelope
GO:0005635	0.880	nuclear envelope
GO:0005643	0.800	nuclear pore
GO:0016604	0.654	nuclear body
GO:0016020	0.644	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.22.-	0.998	Cysteine endopeptidases.

[back to server]