StarFunc result for job id Q9HC73

User Input

>input (371 residues)
MGRLVLLWGAAVFLLGGWMALGQGGAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHY
RFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPS
SPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKC
YSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKFILISSLAI
LLMVSLLLLSLWKLWRVKKFLIPSVPDPKSIFPGLFEIHQGNFQEWITDTQNVAHLHKMA
GAEQESGPEEPLVVQLAKTEAESPRMLDPQTEEKEASGGSLQLPHQPLQGGDVVTIGGFT
FVMNDRSYVAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HC73	1.000	1.000	1.696E-67	371	1.000	1.000	Q9HC73.pdb.gz	CRLF2_HUMAN Cytokine receptor-like factor 2 OS=Homo sapiens OX=9606 GN=CRLF2 PE=1 SV=1
2	AFDB:Q8R4S8	0.482	0.496	1.415E-31	360	0.329	0.339	Q8R4S8.pdb.gz	CRLF2_RAT Cytokine receptor-like factor 2 OS=Rattus norvegicus OX=10116 GN=Crlf2 PE=1 SV=1
3	AFDB:Q8CII9	0.466	0.480	4.490E-28	359	0.340	0.351	Q8CII9.pdb.gz	CRLF2_MOUSE Cytokine receptor-like factor 2 OS=Mus musculus OX=10090 GN=Crlf2 PE=1 SV=2
4	AFDB:A8WH93	0.453	0.463	1.090E-18	362	0.183	0.188	A8WH93.pdb.gz	A8WH93_DANRE Interleukin 2 receptor gamma common.a OS=Danio rerio OX=7955 GN=il-2rgc.a PE=2 SV=1
5	AFDB:A0A0R4IRZ4	0.401	0.299	4.794E-18	509	0.173	0.126	A0A0R4IRZ4.pdb.gz
6	AFDB:P31785	0.434	0.436	5.350E-18	369	0.186	0.187	P31785.pdb.gz	IL2RG_HUMAN Cytokine receptor common subunit gamma OS=Homo sapiens OX=9606 GN=IL2RG PE=1 SV=1
7	AFDB:P19941	0.403	0.248	8.774E-17	638	0.175	0.102	P19941.pdb.gz	GHR_RABIT Growth hormone receptor OS=Oryctolagus cuniculus OX=9986 GN=GHR PE=1 SV=1
8	AFDB:F1MQ39	0.417	0.257	9.791E-17	634	0.181	0.106	F1MQ39.pdb.gz	F1MQ39_BOVIN Growth hormone receptor OS=Bos taurus OX=9913 GN=GHR PE=3 SV=1
9	AFDB:A0A087X0H5	0.393	0.241	4.075E-16	645	0.167	0.096	A0A087X0H5.pdb.gz	A0A087X0H5_HUMAN Growth hormone receptor OS=Homo sapiens OX=9606 GN=GHR PE=1 SV=1
10	AFDB:P16310	0.416	0.254	4.075E-16	638	0.167	0.097	P16310.pdb.gz	GHR_RAT Growth hormone receptor OS=Rattus norvegicus OX=10116 GN=Ghr PE=1 SV=1
11	PDB:7u7nC	0.370	0.622	8.752E-10	200	0.078	0.145	7u7nC.pdb.gz
12	PDB:3besR	0.315	0.430	1.034E-7	250	0.086	0.128	3besR.pdb.gz
13	PDB:7z0lB	0.380	0.381	1.154E-7	370	0.089	0.089	7z0lB.pdb.gz
14	PDB:5mj3A	0.284	0.334	3.655E-6	302	0.086	0.106	5mj3A.pdb.gz
15	PDB:6pxvA	0.248	0.127	1.521E-5	823	0.059	0.027	6pxvA.pdb.gz
16	PDB:8eyyA	0.229	0.123	7.885E-5	775	0.070	0.034	8eyyA.pdb.gz
17	PDB:5oj2B	0.208	0.128	9.295E-5	692	0.070	0.038	5oj2B.pdb.gz
18	PDB:8dtlA	0.255	0.142	1.096E-4	741	0.059	0.030	8dtlA.pdb.gz
19	PDB:7nycA	0.172	0.059	2.635E-4	1542	0.078	0.019	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:7q5zA	0.176	0.066	3.467E-4	1344	0.078	0.022	7q5zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HC73	0.0	775	371	1.000	1.000	CRLF2_HUMAN Cytokine receptor-like factor 2 OS=Homo sapiens OX=9606 GN=CRLF2 PE=1 SV=1
2	Q8R4S8	2.71e-47	166	360	0.326	0.336	CRLF2_RAT Cytokine receptor-like factor 2 OS=Rattus norvegicus OX=10116 GN=Crlf2 PE=1 SV=1
3	Q8CII9	2.92e-40	147	359	0.323	0.334	CRLF2_MOUSE Cytokine receptor-like factor 2 OS=Mus musculus OX=10090 GN=Crlf2 PE=1 SV=2
4	P34902	1.13e-10	64.7	369	0.199	0.201	IL2RG_MOUSE Cytokine receptor common subunit gamma OS=Mus musculus OX=10090 GN=Il2rg PE=1 SV=1
5	P31785	1.02e-09	61.6	369	0.183	0.184	IL2RG_HUMAN Cytokine receptor common subunit gamma OS=Homo sapiens OX=9606 GN=IL2RG PE=1 SV=1
6	Q2VBQ8	5.61e-08	56.6	509	0.129	0.094	Q2VBQ8_DANRE Erythropoietin receptor OS=Danio rerio OX=7955 GN=epor PE=2 SV=1
7	A8WH93	2.31e-06	51.2	362	0.170	0.174	A8WH93_DANRE Interleukin 2 receptor gamma common.a OS=Danio rerio OX=7955 GN=il-2rgc.a PE=2 SV=1
8	Q63216	8.50e-04	43.5	467	0.137	0.109	Q63216_RAT Gfi-2 protein OS=Rattus norvegicus OX=10116 GN=Il9r PE=2 SV=1
9	A0A8I6AHK3	0.001	43.1	468	0.137	0.109	A0A8I6AHK3_RAT Interleukin 9 receptor OS=Rattus norvegicus OX=10116 GN=Il9r PE=4 SV=1
10	G3V8S1	0.001	43.5	467	0.137	0.109	G3V8S1_RAT Interleukin 9 receptor OS=Rattus norvegicus OX=10116 GN=Il9r PE=4 SV=1
11	Q01113	0.002	42.4	521	0.132	0.094	IL9R_HUMAN Interleukin-9 receptor OS=Homo sapiens OX=9606 GN=IL9R PE=1 SV=3
12	Q8VHK6	0.009	40.4	385	0.097	0.094	I13R2_RAT Interleukin-13 receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Il13ra2 PE=2 SV=1
13	Q6NZG4	0.033	38.9	898	0.065	0.027	DDIAS_MOUSE DNA damage-induced apoptosis suppressor protein OS=Mus musculus OX=10090 GN=Ddias PE=2 SV=1
14	O88786	0.038	38.1	383	0.089	0.086	I13R2_MOUSE Interleukin-13 receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Il13ra2 PE=1 SV=1
15	P19235	0.039	38.5	508	0.040	0.030	EPOR_HUMAN Erythropoietin receptor OS=Homo sapiens OX=9606 GN=EPOR PE=1 SV=1
16	P78552	0.048	38.1	427	0.175	0.152	I13R1_HUMAN Interleukin-13 receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=IL13RA1 PE=1 SV=1
17	P14753	0.077	37.4	507	0.038	0.028	EPOR_MOUSE Erythropoietin receptor OS=Mus musculus OX=10090 GN=Epor PE=1 SV=1
18	Q9JHX3	0.084	37.4	529	0.108	0.076	IL21R_MOUSE Interleukin-21 receptor OS=Mus musculus OX=10090 GN=Il21r PE=2 SV=1
19	Q07303	0.10	37.0	507	0.035	0.026	EPOR_RAT Erythropoietin receptor OS=Rattus norvegicus OX=10116 GN=Epor PE=2 SV=1
20	Q4W815	0.21	36.2	525	0.102	0.072	EPOR_XENLA Erythropoietin receptor OS=Xenopus laevis OX=8355 GN=epor PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	50	15.7	Immunoglobulin C1-set domain
2	PF00041 fn3	18	17.1	Fibronectin type III domain
3	PF09240 IL6Ra-bind	1.9e+02	13.9	Interleukin-6 receptor alpha chain, binding
4	PF09294 Interfer-bind	1.5e+02	14.1	Interferon-alpha/beta receptor, fibronectin type III
5	PF01108 Tissue_fac	35	15.7	Tissue factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000383641

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306157	0.999	Interleukin-7 receptor subunit alpha
2	9606.ENSP00000339804	0.999	Thymic stromal lymphopoietin
3	9606.ENSP00000371067	0.989	Tyrosine-protein kinase JAK2
4	9606.ENSP00000263851	0.873	Interleukin-7
5	9606.ENSP00000343204	0.863	Tyrosine-protein kinase JAK1
6	9606.ENSP00000231449	0.852	Interleukin-4
7	9606.ENSP00000391676	0.844	Tyrosine-protein kinase JAK3
8	9606.ENSP00000304915	0.834	Interleukin-13
9	9606.ENSP00000370697	0.827	P2Y purinoceptor 8
10	9606.ENSP00000231454	0.823	Interleukin-5
11	9606.ENSP00000274520	0.779	Interleukin-9
12	9606.ENSP00000296870	0.759	Interleukin-3
13	9606.ENSP00000226730	0.747	Interleukin-2
14	9606.ENSP00000431885	0.736	Non-receptor tyrosine-protein kinase TYK2
15	9606.ENSP00000296545	0.718	Interleukin-15
16	9606.ENSP00000412237	0.717	Interleukin-10
17	9606.ENSP00000215781	0.716	Oncostatin-M
18	9606.ENSP00000331614	0.716	DNA-binding protein Ikaros
19	9606.ENSP00000264657	0.712	Signal transducer and activator of transcription 3
20	9606.ENSP00000341208	0.711	Signal transducer and activator of transcription 5A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004896	1.000	cytokine receptor activity
GO:0005515	0.975	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0050896	0.996	response to stimulus
GO:0048518	0.996	positive regulation of biological process
GO:0042127	0.994	regulation of cell population proliferation
GO:0034097	0.993	response to cytokine
GO:0007166	0.990	cell surface receptor signaling pathway
GO:0048522	0.988	positive regulation of cellular process
GO:0010604	0.981	positive regulation of macromolecule metabolic process
GO:0010468	0.977	regulation of gene expression
GO:0048583	0.976	regulation of response to stimulus
GO:0010628	0.972	positive regulation of gene expression
GO:0048584	0.969	positive regulation of response to stimulus
GO:0008284	0.965	positive regulation of cell population proliferation
GO:0009967	0.955	positive regulation of signal transduction
GO:0051240	0.952	positive regulation of multicellular organismal process
GO:0002682	0.945	regulation of immune system process
GO:0019221	0.940	cytokine-mediated signaling pathway
GO:0001817	0.903	regulation of cytokine production
GO:0001819	0.893	positive regulation of cytokine production
GO:0050865	0.841	regulation of cell activation
GO:0002694	0.816	regulation of leukocyte activation
GO:0002684	0.756	positive regulation of immune system process
GO:0002696	0.632	positive regulation of leukocyte activation
GO:1904892	0.630	regulation of receptor signaling pathway via STAT
GO:1904894	0.590	positive regulation of receptor signaling pathway via STAT
GO:0031323	0.381	regulation of cellular metabolic process
GO:0033003	0.377	regulation of mast cell activation
GO:0002376	0.357	immune system process
GO:0051171	0.343	regulation of nitrogen compound metabolic process
GO:0080090	0.337	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.320	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]