StarFunc result for job id Q9HC77

User Input

>input (1338 residues)
MFLMPTSSELNSGQNFLTQWMTNPSRAGVILNRGFPILEADKEKRAAVDISTSFPIKGTH
FSDSFSFINEEDSLLEEQKLESNNPYKPQSDKSETHTAFPCIKKGPQVAACHSAPGHQEE
NKNDFIPDLASEFKEGAYKDPLFKKLEQLKEVQQKKQEQLKRQQLEQLQRLMEEQEKLLT
MVSGQCTLPGLSLLPDDQSQKHRSPGNTTTGERATCCFPSYVYPDPTQEETYPSNILSHE
QSNFCRTAHGDFVLTSKRASPNLFSEAQYQEAPVEKNNLKEENRNHPTGESILCWEKVTE
QIQEANDKNLQKHDDSSEVANIEERPIKAAIGERKQTFEDYLEEQIQLEEQELKQKQLKE
AEGPLPIKAKPKQPFLKRGEGLARFTNAKSKFQKGKESKLVTNQSTSEDQPLFKMDRQQL
QRKTALKNKELCADNPILKKDSKARTKSGSVTLSQKPKMLKCSNRKSLSPSGLKIQTGKK
CDGQFRDQIKFENKVTSNNKENVTECPKPCDTGCTGWNKTQGKDRLPLSTGPASRLAAKS
PIRETMKESESSLDVSLQKKLETWEREKEKENLELDEFLFLEQAADEISFSSNSSFVLKI
LERDQQICKGHRMSSTPVKAVPQKTNPADPISHCNRSEDLDHTAREKESECEVAPKQLHS
LSSADELREQPCKIRKAVQKSTSENQTEWNARDDEGVPNSDSSTDSEEQLDVTIKPSTED
RERGISSREDSPQVCDDKGPFKDTRTQEDKRRDVDLDLSDKDYSSDESIMESIKHKVSEP
SRSSSLSLSKMDFDDERTWTDLEENLCNHDVVLGNESTYGTPQTCYPNNEIGILDKTIKR
KIAPVKRGEDLSKSRRSRSPPTSELMMKFFPSLKPKPKSDSHLGNELKLNISQDQPPGDN
ARSQVLREKIIELETEIEKFKAENASLAKLRIERESALEKLRKEIADFEQQKAKELARIE
EFKKEEMRKLQKERKVFEKYTTAARTFPDKKEREEIQTLKQQIADLREDLKRKETKWSST
HSRLRSQIQMLVRENTDLREEIKVMERFRLDAWKRAEAIESSLEVEKKDKLANTSVRFQN
SQISSGTQVEKYKKNYLPMQGNPPRRSKSAPPRDLGNLDKGQAASPREPLEPLNFPDPEY
KEEEEDQDIQGEISHPDGKVEKVYKNGCRVILFPNGTRKEVSADGKTITVTFFNGDVKQV
MPDQRVIYYYAAAQTTHTTYPEGLEVLHFSSGQIEKHYPDGRKEITFPDQTVKNLFPDGQ
EESIFPDGTIVRVQRDGNKLIEFNNGQRELHTAQFKRREYPDGTVKTVYANGHQETKYRS
GRIRVKDKEGNVLMDTEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q569L8	0.174	0.173	0.000	1344	0.738	0.735	Q569L8.pdb.gz	CENPJ_MOUSE Centromere protein J OS=Mus musculus OX=10090 GN=Cenpj PE=2 SV=2
2	AFDB:Q9HC77	1.000	1.000	0.000	1338	1.000	1.000	Q9HC77.pdb.gz	CENPJ_HUMAN Centromere protein J OS=Homo sapiens OX=9606 GN=CENPJ PE=1 SV=2
3	AFDB:Q9H2Y7	0.054	0.043	5.996E-5	1883	0.132	0.093	Q9H2Y7.pdb.gz	ZN106_HUMAN Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1
4	PDB:4pk1A	0.053	0.110	7.992E-5	494	0.028	0.075	4pk1A.pdb.gz
5	PDB:5wyjBA	0.065	0.095	1.100E-4	755	0.025	0.045	5wyjBA.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
6	PDB:6lqsB1	0.067	0.097	1.360E-4	806	0.022	0.037	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
7	PDB:8gqeB	0.048	0.126	1.595E-4	386	0.016	0.054	8gqeB.pdb.gz
8	AFDB:O88466	0.071	0.055	2.956E-4	1888	0.141	0.100	O88466.pdb.gz	ZN106_MOUSE Zinc finger protein 106 OS=Mus musculus OX=10090 GN=Znf106 PE=1 SV=3
9	PDB:7nsb7	0.052	0.090	3.735E-4	531	0.021	0.053	7nsb7.pdb.gz
10	PDB:6rtdB	0.046	0.097	3.939E-4	466	0.027	0.077	6rtdB.pdb.gz	Crystal Structure of Dihydro-Heme d1Dehydrogenase NirN from Pseudomonas aeruginosa Reveals Amino Acid Residues Essential for Catalysis.
11	PDB:7mq8LO	0.059	0.083	4.154E-4	848	0.020	0.032	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7mq8LT	0.046	0.062	4.873E-4	869	0.022	0.035	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:5k1aF	0.052	0.098	5.419E-4	600	0.024	0.053	5k1aF.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
14	PDB:7mqaLQ	0.047	0.069	7.456E-4	830	0.024	0.039	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	AFDB:B7YZK8	0.046	0.043	1.059E-3	1517	0.123	0.108	B7YZK8.pdb.gz	B7YZK8_DROME Thin, isoform C OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
16	AFDB:Q9FM57	0.070	0.055	1.178E-3	1826	0.134	0.098	Q9FM57.pdb.gz	Q9FM57_ARATH Inner centromere protein, ARK-binding region protein OS=Arabidopsis thaliana OX=3702 GN=WYR PE=1 SV=1
17	AFDB:Q9VZF4	0.057	0.058	1.709E-3	1326	0.138	0.140	Q9VZF4.pdb.gz	FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster OX=7227 GN=ago PE=1 SV=1
18	AFDB:P29617	0.058	0.051	1.802E-3	1703	0.119	0.093	P29617.pdb.gz	PROS_DROME Homeobox protein prospero OS=Drosophila melanogaster OX=7227 GN=pros PE=1 SV=3
19	AFDB:D6RAA5	0.081	0.101	9.366E-3	1008	0.110	0.146	D6RAA5.pdb.gz	D6RAA5_HUMAN Transforming acidic coiled-coil containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=1
20	AFDB:Q10124	0.050	0.043	1.870E-2	1647	0.109	0.089	Q10124.pdb.gz	PQE1_CAEEL Putative RNA exonuclease pqe-1 OS=Caenorhabditis elegans OX=6239 GN=pqe-1 PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q569L8	0.0	1884	1344	0.737	0.734	CENPJ_MOUSE Centromere protein J OS=Mus musculus OX=10090 GN=Cenpj PE=2 SV=2
2	Q9HC77	0.0	2758	1338	1.000	1.000	CENPJ_HUMAN Centromere protein J OS=Homo sapiens OX=9606 GN=CENPJ PE=1 SV=2
3	E7FCY1	1.46e-143	468	1124	0.192	0.229	E7FCY1_DANRE Centromere protein J OS=Danio rerio OX=7955 GN=cenpj PE=1 SV=1
4	Q9VI72	5.70e-43	172	901	0.064	0.094	Q9VI72_DROME Spindle assembly abnormal 4 OS=Drosophila melanogaster OX=7227 GN=Sas-4 PE=1 SV=2
5	Q386I1	1.80e-25	117	932	0.039	0.056	Q386I1_TRYB2 Centromere protein J C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0810 PE=3 SV=1
6	Q8TDR4	4.52e-07	54.3	215	0.021	0.130	TCP1L_HUMAN T-complex protein 10A homolog 1 OS=Homo sapiens OX=9606 GN=TCP10L PE=1 SV=1
7	Q10432	0.088	39.7	735	0.032	0.059	CCQ1_SCHPO Coiled-coil quantitatively-enriched protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ccq1 PE=1 SV=1
8	Q9JMH9	0.16	38.9	2050	0.052	0.034	MY18A_MOUSE Unconventional myosin-XVIIIa OS=Mus musculus OX=10090 GN=Myo18a PE=1 SV=2
9	Q12840	0.28	38.1	1032	0.046	0.059	KIF5A_HUMAN Kinesin heavy chain isoform 5A OS=Homo sapiens OX=9606 GN=KIF5A PE=1 SV=2
10	P33175	0.39	37.7	1027	0.046	0.059	KIF5A_MOUSE Kinesin heavy chain isoform 5A OS=Mus musculus OX=10090 GN=Kif5a PE=1 SV=3
11	Q92614	0.40	37.7	2054	0.038	0.025	MY18A_HUMAN Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A PE=1 SV=3
12	Q6QLM7	0.41	37.7	1027	0.046	0.059	KIF5A_RAT Kinesin heavy chain isoform 5A OS=Rattus norvegicus OX=10116 GN=Kif5a PE=1 SV=1
13	Q6PKC3	0.51	37.4	985	0.031	0.042	TXD11_HUMAN Thioredoxin domain-containing protein 11 OS=Homo sapiens OX=9606 GN=TXNDC11 PE=1 SV=2
14	Q8MSS1	3.9	34.3	2779	0.028	0.014	LVA_DROME Protein lava lamp OS=Drosophila melanogaster OX=7227 GN=lva PE=1 SV=2
15	H0YHT2	4.4	34.3	975	0.031	0.043	H0YHT2_HUMAN Kinesin family member 21A (Fragment) OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=1
16	Q0P6H7	5.4	33.5	446	0.019	0.058	Q0P6H7_HUMAN TRIM29 protein OS=Homo sapiens OX=9606 GN=TRIM29 PE=1 SV=2
17	A0A1B0GV47	5.9	33.9	1653	0.031	0.025	A0A1B0GV47_HUMAN Kinesin family member 21A (Fragment) OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=1
18	Q7Z4S6	5.9	33.9	1674	0.031	0.025	KI21A_HUMAN Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=2
19	Q0PAH3	6.2	33.1	238	0.039	0.218	Q0PAH3_CAMJE C4-type zinc ribbon domain-containing protein OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=Cj0706 PE=1 SV=1
20	Q3UU96	8.3	33.5	1719	0.025	0.020	MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha OS=Mus musculus OX=10090 GN=Cdc42bpa PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18938 aRib	4.6e+02	12.1	Atypical Rib domain
2	PF03990 DUF348	2.7e+02	12.9	G5-linked-Ubiquitin-like domain
3	PF07202 Tcp10_C	5.9e-50	177.9	T-complex protein 10 C-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371308

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370337	0.999	Centrosomal protein of 152 kDa
2	9606.ENSP00000360944	0.998	SCL-interrupting locus protein
3	9606.ENSP00000287482	0.996	Spindle assembly abnormal protein 6 homolog
4	9606.ENSP00000257287	0.994	Centrosomal protein of 135 kDa
5	9606.ENSP00000343818	0.991	CDK5 regulatory subunit-associated protein 2
6	9606.ENSP00000248846	0.975	Gamma-tubulin complex component 6
7	9606.ENSP00000251413	0.974	Tubulin gamma-1 chain
8	9606.ENSP00000270861	0.970	Serine/threonine-protein kinase PLK4
9	9606.ENSP00000274289	0.959	Serine/threonine-protein kinase PLK2
10	9606.ENSP00000370803	0.951	Centriolar coiled-coil protein of 110 kDa
11	9606.ENSP00000356379	0.947	Abnormal spindle-like microcephaly-associated protein
12	9606.ENSP00000480316	0.946	Gamma-tubulin complex component 5
13	9606.ENSP00000260383	0.939	Gamma-tubulin complex component 4
14	9606.ENSP00000384792	0.928	WD repeat-containing protein 62
15	9606.ENSP00000352572	0.927	Pericentrin
16	9606.ENSP00000367049	0.926	Mitotic-spindle organizing protein 1
17	9606.ENSP00000359398	0.923	Biogenesis of lysosome-related organelles complex 1 subunit 2
18	9606.ENSP00000418960	0.921	Breast cancer type 1 susceptibility protein
19	9606.ENSP00000281871	0.903	Mitotic spindle organizing protein 2B
20	9606.ENSP00000342924	0.893	Microcephalin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019904	0.999	protein domain specific binding
GO:0015631	0.992	tubulin binding
GO:0019901	0.990	protein kinase binding
GO:0042802	0.985	identical protein binding
GO:0003713	0.981	transcription coactivator activity
GO:0043015	0.978	gamma-tubulin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	1.000	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0016043	0.988	cellular component organization
GO:0006996	0.972	organelle organization
GO:0007017	0.930	microtubule-based process
GO:0007010	0.925	cytoskeleton organization
GO:0000226	0.924	microtubule cytoskeleton organization
GO:0048522	0.921	positive regulation of cellular process
GO:0022402	0.907	cell cycle process
GO:0010564	0.906	regulation of cell cycle process
GO:0033043	0.901	regulation of organelle organization
GO:0022607	0.893	cellular component assembly
GO:0032886	0.881	regulation of microtubule-based process
GO:0045787	0.848	positive regulation of cell cycle
GO:0051130	0.835	positive regulation of cellular component organization
GO:0070925	0.834	organelle assembly
GO:0044089	0.832	positive regulation of cellular component biogenesis
GO:0090068	0.829	positive regulation of cell cycle process
GO:0010638	0.819	positive regulation of organelle organization
GO:0140694	0.812	non-membrane-bounded organelle assembly
GO:0007098	0.806	centrosome cycle
GO:1902115	0.804	regulation of organelle assembly
GO:0010824	0.790	regulation of centrosome duplication
GO:1902117	0.763	positive regulation of organelle assembly
GO:0051298	0.759	centrosome duplication
GO:0032879	0.726	regulation of localization
GO:0007099	0.724	centriole replication
GO:0060341	0.650	regulation of cellular localization
GO:0097435	0.563	supramolecular fiber organization
GO:0051493	0.511	regulation of cytoskeleton organization
GO:0007051	0.474	spindle organization
GO:1901987	0.441	regulation of cell cycle phase transition
GO:0007346	0.438	regulation of mitotic cell cycle
GO:0048583	0.433	regulation of response to stimulus
GO:1903829	0.402	positive regulation of protein localization
GO:0031109	0.395	microtubule polymerization or depolymerization
GO:0051495	0.380	positive regulation of cytoskeleton organization
GO:0065003	0.378	protein-containing complex assembly
GO:1901990	0.369	regulation of mitotic cell cycle phase transition
GO:0023051	0.348	regulation of signaling
GO:0010646	0.348	regulation of cell communication
GO:0009966	0.344	regulation of signal transduction
GO:0051258	0.341	protein polymerization
GO:0050896	0.333	response to stimulus
GO:0046785	0.332	microtubule polymerization
GO:0048584	0.327	positive regulation of response to stimulus
GO:1902806	0.324	regulation of cell cycle G1/S phase transition
GO:0007020	0.318	microtubule nucleation
GO:0045931	0.311	positive regulation of mitotic cell cycle
GO:1902808	0.305	positive regulation of cell cycle G1/S phase transition

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005814	1.000	centriole
GO:0005813	0.998	centrosome
GO:0005829	0.996	cytosol
GO:0032991	0.995	protein-containing complex
GO:0043227	0.970	membrane-bounded organelle
GO:0043231	0.796	intracellular membrane-bounded organelle
GO:0005634	0.455	nucleus
GO:0120099	0.399	procentriole replication complex
GO:0070013	0.371	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]