StarFunc result for job id Q9HC78

User Input

>input (741 residues)
MLERKKPKTAENQKASEENEITQPGGSSAKPGLPCLNFEAVLSPDPALIHSTHSLTNSHA
HTGSSDCDISCKGMTERIHSINLHNFSNSVLETLNEQRNRGHFCDVTVRIHGSMLRAHRC
VLAAGSPFFQDKLLLGYSDIEIPSVVSVQSVQKLIDFMYSGVLRVSQSEALQILTAASIL
QIKTVIDECTRIVSQNVGDVFPGIQDSGQDTPRGTPESGTSGQSSDTESGYLQSHPQHSV
DRIYSALYACSMQNGSGERSFYSGAVVSHHETALGLPRDHHMEDPSWITRIHERSQQMER
YLSTTPETTHCRKQPRPVRIQTLVGNIHIKQEMEDDYDYYGQQRVQILERNESEECTEDT
DQAEGTESEPKGESFDSGVSSSIGTEPDSVEQQFGPGAARDSQAEPTQPEQAAEAPAEGG
PQTNQLETGASSPERSNEVEMDSTVITVSNSSDKSVLQQPSVNTSIGQPLPSTQLYLRQT
ETLTSNLRMPLTLTSNTQVIGTAGNTYLPALFTTQPAGSGPKPFLFSLPQPLAGQQTQFV
TVSQPGLSTFTAQLPAPQPLASSAGHSTASGQGEKKPYECTLCNKTFTAKQNYVKHMFVH
TGEKPHQCSICWRSFSLKDYLIKHMVTHTGVRAYQCSICNKRFTQKSSLNVHMRLHRGEK
SYECYICKKKFSHKTLLERHVALHSASNGTPPAGTPPGARAGPPGVVACTEGTTYVCSVC
PAKFDQIEQFNDHMRMHVSDG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O95201	0.183	0.239	2.521E-15	554	0.140	0.188	O95201.pdb.gz	RHIT_HUMAN Transcriptional repressor RHIT OS=Homo sapiens OX=9606 GN=ZNF205 PE=1 SV=2
2	AFDB:Q8BGV5	0.158	0.203	3.453E-15	572	0.127	0.164	Q8BGV5.pdb.gz	ZNF8_MOUSE Zinc finger protein 8 OS=Mus musculus OX=10090 GN=Znf8 PE=1 SV=1
3	AFDB:Q923B3	0.162	0.146	4.388E-13	828	0.167	0.150	Q923B3.pdb.gz	NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus OX=10090 GN=Nrif1 PE=1 SV=3
4	AFDB:Q5BIH1	0.136	0.126	6.400E-13	803	0.166	0.153	Q5BIH1.pdb.gz	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
5	AFDB:Q14526	0.166	0.167	9.942E-13	733	0.179	0.181	Q14526.pdb.gz	HIC1_HUMAN Hypermethylated in cancer 1 protein OS=Homo sapiens OX=9606 GN=HIC1 PE=1 SV=5
6	AFDB:Q9VED3	0.114	0.072	1.989E-7	1186	0.139	0.087	Q9VED3.pdb.gz	Q9VED3_DROME Stripe, isoform A OS=Drosophila melanogaster OX=7227 GN=sr PE=4 SV=1
7	AFDB:B9WEF9	0.117	0.122	3.974E-7	708	0.150	0.157	B9WEF9.pdb.gz	B9WEF9_CANDC Transcriptional regulator, putative OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) OX=573826 GN=CRZ1 PE=4 SV=1
8	AFDB:A0A5K4F1D0	0.136	0.042	6.174E-7	2566	0.146	0.042	A0A5K4F1D0.pdb.gz	GLI1_SCHMA Zinc finger protein GLI1 OS=Schistosoma mansoni OX=6183 GN=gli1 PE=2 SV=1
9	AFDB:A0A131MCL4	0.062	0.069	3.376E-6	646	0.131	0.150	A0A131MCL4.pdb.gz	A0A131MCL4_CAEEL C2H2-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=die-1 PE=1 SV=1
10	AFDB:M9NEG1	0.115	0.080	6.333E-6	1109	0.152	0.102	M9NEG1.pdb.gz	M9NEG1_DROME Maternal gene required for meiosis, isoform F OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=1
11	PDB:7r5jV0	0.045	0.105	7.910E-1	273	0.040	0.110	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:5gm6a	0.031	0.114	4.061	123	0.026	0.154	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
13	PDB:7enag	0.055	0.180	4.606	166	0.032	0.145	7enag.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
14	PDB:7mqaSS	0.042	0.068	4.905	350	0.054	0.114	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:6gejS	0.038	0.102	5.563	208	0.038	0.135	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
16	PDB:6qlfQ	0.045	0.155	6.309	204	0.039	0.142	6qlfQ.pdb.gz
17	PDB:4n78F	0.043	0.168	7.619	156	0.019	0.090	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
18	PDB:6wucH	0.050	0.164	8.641	179	0.045	0.184	6wucH.pdb.gz
19	PDB:7uhyD	0.027	0.062	9.202	288	0.022	0.056	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8K0L9	0.0	1505	741	0.977	0.977	ZBT20_MOUSE Zinc finger and BTB domain-containing protein 20 OS=Mus musculus OX=10090 GN=Zbtb20 PE=1 SV=1
2	Q9HC78	0.0	1541	741	1.000	1.000	ZBT20_HUMAN Zinc finger and BTB domain-containing protein 20 OS=Homo sapiens OX=9606 GN=ZBTB20 PE=1 SV=3
3	Q96K62	2.08e-51	189	511	0.113	0.164	ZBT45_HUMAN Zinc finger and BTB domain-containing protein 45 OS=Homo sapiens OX=9606 GN=ZBTB45 PE=1 SV=1
4	P13360	2.03e-29	126	604	0.082	0.101	GLAS_DROME Protein glass OS=Drosophila melanogaster OX=7227 GN=gl PE=1 SV=2
5	Q61967	2.25e-29	126	636	0.096	0.112	ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus OX=10090 GN=Zfp90 PE=1 SV=1
6	Q4V8A8	5.12e-28	122	633	0.093	0.109	ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus OX=10116 GN=Zfp90 PE=2 SV=1
7	Q9H707	5.69e-28	119	407	0.099	0.179	ZN552_HUMAN Zinc finger protein 552 OS=Homo sapiens OX=9606 GN=ZNF552 PE=1 SV=2
8	Q9C0F3	9.83e-28	119	470	0.073	0.115	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
9	Q6P2D0	1.60e-27	117	407	0.086	0.157	ZFP1_HUMAN Zinc finger protein 1 homolog OS=Homo sapiens OX=9606 GN=ZFP1 PE=1 SV=2
10	P51814	1.84e-27	121	821	0.085	0.077	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
11	Q15072	2.55e-27	114	292	0.089	0.226	OZF_HUMAN Zinc finger protein OZF OS=Homo sapiens OX=9606 GN=ZNF146 PE=1 SV=2
12	Q9NQZ8	3.62e-27	118	489	0.073	0.110	ZNF71_HUMAN Endothelial zinc finger protein induced by tumor necrosis factor alpha OS=Homo sapiens OX=9606 GN=ZNF71 PE=1 SV=1
13	P17041	1.00e-26	112	273	0.090	0.245	ZNF32_HUMAN Zinc finger protein 32 OS=Homo sapiens OX=9606 GN=ZNF32 PE=1 SV=2
14	P17014	1.04e-26	118	697	0.096	0.102	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
15	Q96LW9	1.09e-26	115	406	0.073	0.133	ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens OX=9606 GN=ZSCAN31 PE=1 SV=2
16	A0A0S2Z658	1.21e-26	117	545	0.085	0.116	A0A0S2Z658_HUMAN Zinc finger with KRAB and SCAN domains 4 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ZKSCAN4 PE=2 SV=1
17	Q969J2	1.21e-26	117	545	0.085	0.116	ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens OX=9606 GN=ZKSCAN4 PE=1 SV=1
18	P10073	1.28e-26	116	491	0.080	0.120	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
19	Q9NX65	1.43e-26	118	697	0.082	0.088	ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens OX=9606 GN=ZSCAN32 PE=1 SV=3
20	Q147U1	1.45e-26	117	533	0.086	0.120	ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens OX=9606 GN=ZNF846 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01722 BolA	7.2	18.4	BolA-like protein
2	PF00651 BTB	2.1e-20	84.4	BTB/POZ domain
3	PF19126 DUF5810	69	15.0	Family of unknown function (DUF5810)
4	PF00096 zf-C2H2	5.2e-19	78.7	Zinc finger, C2H2 type
5	PF16622 zf-C2H2_11	8.2	17.6	zinc-finger C2H2-type
6	PF12756 zf-C2H2_2	3.6	19.3	C2H2 type zinc-finger (2 copies)
7	PF13894 zf-C2H2_4	9.2e-13	58.9	C2H2-type zinc finger
8	PF13912 zf-C2H2_6	0.0074	27.5	C2H2-type zinc finger
9	PF12171 zf-C2H2_jaz	0.89	21.2	Zinc-finger double-stranded RNA-binding
10	PF13913 zf-C2HC_2	0.017	26.2	zinc-finger of a C2HC-type
11	PF05605 zf-Di19	15	17.3	Drought induced 19 protein (Di19), zinc-binding
12	PF13465 zf-H2C2_2	1.4e-19	80.7	Zinc-finger double domain
13	PF12874 zf-met	0.24	23.1	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000419153

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000314709	0.765	Zinc fingers and homeoboxes protein 2
2	9606.ENSP00000379138	0.720	Alpha-fetoprotein
3	9606.ENSP00000383232	0.720	Glutathione hydrolase 1 proenzyme
4	9606.ENSP00000272133	0.663	Protein cornichon homolog 3
5	9606.ENSP00000255784	0.619	Coiled-coil domain-containing protein 134
6	9606.ENSP00000226355	0.605	Afamin
7	9606.ENSP00000261731	0.601	LIM/homeobox protein Lhx5
8	9606.ENSP00000398273	0.600	Transcription factor SOX-5
9	9606.ENSP00000419000	0.583	Limbic system-associated membrane protein
10	9606.ENSP00000386357	0.572	Leucine-rich repeat transmembrane neuronal protein 4
11	9606.ENSP00000360231	0.562	Nuclear factor 1 A-type
12	9606.ENSP00000405327	0.561	ETS translocation variant 1
13	9606.ENSP00000401112	0.557	DNA-binding protein SATB2
14	9606.ENSP00000294168	0.547	TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L
15	9606.ENSP00000347836	0.515	Ubiquitin-conjugating enzyme E2 H
16	9606.ENSP00000439402	0.501	Zinc finger protein 667

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0003700	0.955	DNA-binding transcription factor activity
GO:0000981	0.752	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001067	0.599	transcription regulatory region nucleic acid binding
GO:0000976	0.594	transcription cis-regulatory region binding
GO:0001217	0.469	DNA-binding transcription repressor activity
GO:0001227	0.426	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0010468	0.992	regulation of gene expression
GO:0031326	0.990	regulation of cellular biosynthetic process
GO:0010556	0.987	regulation of macromolecule biosynthetic process
GO:0019219	0.986	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.980	regulation of DNA-templated transcription
GO:0048519	0.922	negative regulation of biological process
GO:0048523	0.911	negative regulation of cellular process
GO:0031324	0.902	negative regulation of cellular metabolic process
GO:0045934	0.894	negative regulation of nucleobase-containing compound metabolic process
GO:0045892	0.868	negative regulation of DNA-templated transcription
GO:0009987	0.866	cellular process
GO:0006357	0.578	regulation of transcription by RNA polymerase II
GO:0048518	0.456	positive regulation of biological process
GO:0048522	0.328	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0005737	0.988	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]