StarFunc result for job id Q9HC84

User Input

>input (1400 residues)
MGAPSACRTLVLALAAMLVVPQAETQGPVEPSWENAGHTMDGGAPTSSPTRRVSFVPPVT
VFPSLSPLNPAHNGRVCSTWGDFHYKTFDGDVFRFPGLCNYVFSEHCRAAYEDFNVQLRR
GLVGSRPVVTRVVIKAQGLVLEASNGSVLINGQREELPYSRTGLLVEQSGDYIKVSIRLV
LTFLWNGEDSALLELDPKYANQTCGLCGDFNGLPAFNEFYAHNARLTPLQFGNLQKLDGP
TEQCPDPLPLPAGNCTDEEGICHRTLLGPAFAECHALVDSTAYLAACAQDLCRCPTCPCA
TFVEYSRQCAHAGGQPRNWRCPELCPRTCPLNMQHQECGSPCTDTCSNPQRAQLCEDHCV
DGCFCPPGTVLDDITHSGCLPLGQCPCTHGGRTYSPGTSFNTTCSSCTCSGGLWQCQDLP
CPGTCSVQGGAHISTYDEKLYDLHGDCSYVLSKKCADSSFTVLAELRKCGLTDNENCLKA
VTLSLDGGDTAIRVQADGGVFLNSIYTQLPLSAANITLFTPSSFFIVVQTGLGLQLLVQL
VPLMQVFVRLDPAHQGQMCGLCGNFNQNQADDFTALSGVVEATGAAFANTWKAQAACANA
RNSFEDPCSLSVENENYARHWCSRLTDPNSAFSRCHSIINPKPFHSNCMFDTCNCERSED
CLCAALSSYVHACAAKGVQLSDWRDGVCTKYMQNCPKSQRYAYVVDACQPTCRGLSEADV
TCSVSFVPVDGCTCPAGTFLNDAGACVPAQECPCYAHGTVLAPGEVVHDEGAVCSCTGGK
LSCLGASLQKSTGCAAPMVYLDCSNSSAGTPGAECLRSCHTLDVGCFSTHCVSGCVCPPG
LVSDGSGGCIAEEDCPCVHNEATYKPGETIRVDCNTCTCRNRRWECSHRLCLGTCVAYGD
GHFITFDGDRYSFEGSCEYILAQDYCGDNTTHGTFRIVTENIPCGTTGTTCSKAIKLFVE
SYELILQEGTFKAVARGPGGDPPYKIRYMGIFLVIETHGMAVSWDRKTSVFIRLHQDYKG
RVCGLCGNFDDNAINDFATRSRSVVGDALEFGNSWKLSPSCPDALAPKDPCTANPFRKSW
AQKQCSILHGPTFAACRSQVDSTKYYEACVNDACACDSGGDCECFCTAVAAYAQACHDAG
LCVSWRTPDTCPLFCDFYNPHGGCEWHYQPCGAPCLKTCRNPSGHCLVDLPGLEGCYPKC
PPSQPFFNEDQMKCVAQCGCYDKDGNYYDVGARVPTAENCQSCNCTPSGIQCAHSLEACT
CTYEDRTYSYQDVIYNTTDGLGACLIAICGSNGTIIRKAVACPGTPATTPFTFTTAWVPH
STTSPALPVSTVCVREVCRWSSWYNGHRPEPGLGGGDFETFENLRQRGYQVCPVLADIEC
RAAQLPDMPLEELGQQVDCD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K1Y4	0.760	0.961	0.000	1103	0.519	0.658	A0A0G2K1Y4.pdb.gz	A0A0G2K1Y4_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
2	AFDB:F1NBL0	0.735	0.863	0.000	1185	0.314	0.370	F1NBL0.pdb.gz	MUC6_CHICK Mucin-6 (Fragment) OS=Gallus gallus OX=9031 GN=MUC6 PE=1 SV=1
3	AFDB:Q6W4X9	0.759	0.442	0.000	2439	0.351	0.202	Q6W4X9.pdb.gz	MUC6_HUMAN Mucin-6 OS=Homo sapiens OX=9606 GN=MUC6 PE=1 SV=3
4	AFDB:Q80Z19	0.473	0.253	0.000	2680	0.456	0.238	Q80Z19.pdb.gz	MUC2_MOUSE Mucin-2 OS=Mus musculus OX=10090 GN=Muc2 PE=1 SV=3
5	AFDB:Q98UI9	0.787	0.528	0.000	2108	0.391	0.260	Q98UI9.pdb.gz	MUC5B_CHICK Mucin-5B OS=Gallus gallus OX=9031 GN=MUC5B PE=1 SV=1
6	AFDB:Q3ZCN5	0.425	0.265	1.657E-88	2332	0.273	0.164	Q3ZCN5.pdb.gz	OTOGL_HUMAN Otogelin-like protein OS=Homo sapiens OX=9606 GN=OTOGL PE=1 SV=6
7	AFDB:A0A286YAF1	0.385	0.263	1.765E-85	2146	0.259	0.169	A0A286YAF1.pdb.gz
8	AFDB:Q28983	0.223	0.129	6.044E-69	2476	0.226	0.128	Q28983.pdb.gz	ZAN_PIG Zonadhesin OS=Sus scrofa OX=9823 GN=ZAN PE=1 SV=1
9	AFDB:E9Q0B5	0.222	0.124	1.048E-65	2583	0.250	0.136	E9Q0B5.pdb.gz	E9Q0B5_MOUSE Fc fragment of IgG binding protein OS=Mus musculus OX=10090 GN=Fcgbp PE=1 SV=1
10	AFDB:O08523	0.211	0.143	5.499E-65	2155	0.209	0.135	O08523.pdb.gz	TECTA_MOUSE Alpha-tectorin OS=Mus musculus OX=10090 GN=Tecta PE=1 SV=2
11	PDB:6z3mc	0.085	0.640	5.461E-4	158	0.012	0.108	6z3mc.pdb.gz	Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.
12	PDB:7dvq3	0.054	0.060	5.604E-2	1193	0.042	0.049	7dvq3.pdb.gz	Structure of the activated human minor spliceosome.
13	PDB:2hyeA	0.051	0.057	7.508E-2	1140	0.044	0.054	2hyeA.pdb.gz	Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
14	PDB:5hxbY	0.055	0.062	8.277E-2	1080	0.035	0.045	5hxbY.pdb.gz	A novel cereblon modulator recruits GSPT1 to the CRL4(CRBN) ubiquitin ligase.
15	PDB:6r8yK	0.039	0.053	1.109E-1	825	0.039	0.065	6r8yK.pdb.gz	DNA damage detection in nucleosomes involves DNA register shifting.
16	PDB:6n8sA	0.045	0.063	1.486E-1	834	0.040	0.067	6n8sA.pdb.gz
17	PDB:1w6mA	0.043	0.226	1.560E-1	134	0.012	0.127	1w6mA.pdb.gz	Growth-Regulatory Human Galectin-1: Crystallographic Characterisation of the Structural Changes Induced by Single-Site Mutations and Their Impact on the Thermodynamics of Ligand Binding.
18	PDB:2a3wA	0.034	0.141	1.560E-1	204	0.021	0.142	2a3wA.pdb.gz	Ligand-assisted Aggregation of Proteins: DIMERIZATION OF SERUM AMYLOID P COMPONENT BY BIVALENT LIGANDS.
19	PDB:6l6aA	0.042	0.267	1.720E-1	142	0.018	0.176	6l6aA.pdb.gz	Structures of human galectin-10/monosaccharide complexes demonstrate potential of monosaccharides as effectors in forming Charcot-Leyden crystals.
20	PDB:4ga9A	0.042	0.229	2.304E-1	134	0.013	0.134	4ga9A.pdb.gz	Gal-1 structure analysis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K1Y4	1734	3586	0.610	0.238	A0A0G2K1Y4_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
2	A0A0G2K8X5	1735	3922	0.610	0.218	A0A0G2K8X5_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
3	E7F9Z1	756	2812	0.314	0.156	E7F9Z1_DANRE von Willebrand factor OS=Danio rerio OX=7955 GN=VWF PE=1 SV=3
4	E9PWB6	1687	2751	0.573	0.292	E9PWB6_MOUSE Mucin 5, subtypes A and C, tracheobronchial/gastric OS=Mus musculus OX=10090 GN=Muc5ac PE=1 SV=1
5	E9Q5I3	2243	4800	0.753	0.220	E9Q5I3_MOUSE Mucin 5, subtype B, tracheobronchial OS=Mus musculus OX=10090 GN=Muc5b PE=1 SV=1
6	E9QAQ8	1698	3455	0.574	0.232	E9QAQ8_MOUSE Mucin 5, subtypes A and C, tracheobronchial/gastric OS=Mus musculus OX=10090 GN=Muc5ac PE=1 SV=5
7	F1NBL0	827	1185	0.314	0.370	MUC6_CHICK Mucin-6 (Fragment) OS=Gallus gallus OX=9031 GN=MUC6 PE=1 SV=1
8	P04275	695	2813	0.300	0.149	VWF_HUMAN von Willebrand factor OS=Homo sapiens OX=9606 GN=VWF PE=1 SV=4
9	P98088	1784	5654	0.614	0.152	MUC5A_HUMAN Mucin-5AC OS=Homo sapiens OX=9606 GN=MUC5AC PE=1 SV=4
10	Q02817	1280	5179	0.464	0.126	MUC2_HUMAN Mucin-2 OS=Homo sapiens OX=9606 GN=MUC2 PE=1 SV=3
11	Q62635	1255	1513	0.447	0.414	MUC2_RAT Mucin-2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Muc2 PE=1 SV=1
12	Q6PZE0	699	7524	0.311	0.058	MUC19_MOUSE Mucin-19 OS=Mus musculus OX=10090 GN=Muc19 PE=2 SV=2
13	Q6W4X9	825	2439	0.336	0.193	MUC6_HUMAN Mucin-6 OS=Homo sapiens OX=9606 GN=MUC6 PE=1 SV=3
14	Q7Z5P9	710	8384	0.319	0.053	MUC19_HUMAN Mucin-19 OS=Homo sapiens OX=9606 GN=MUC19 PE=1 SV=3
15	Q80Z19	1248	2680	0.455	0.238	MUC2_MOUSE Mucin-2 OS=Mus musculus OX=10090 GN=Muc2 PE=1 SV=3
16	Q8BYW0	2208	1477	0.753	0.714	Q8BYW0_MOUSE VWFD domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1
17	Q8CIZ8	697	2813	0.300	0.149	VWF_MOUSE von Willebrand factor OS=Mus musculus OX=10090 GN=Vwf PE=1 SV=2
18	Q8K1G6	2237	4782	0.752	0.220	Q8K1G6_MOUSE Muc5b protein OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1
19	Q98UI9	1139	2108	0.391	0.259	MUC5B_CHICK Mucin-5B OS=Gallus gallus OX=9031 GN=MUC5B PE=1 SV=1
20	Q9ESP3	1738	1851	0.609	0.461	Q9ESP3_RAT Mucin (Fragment) OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08742 C8	7.8e-44	159.2	C8 domain
2	PF13330 Mucin2_WxxW	6e-08	44.7	Mucin-2 protein WxxW repeating region
3	PF01826 TIL	3.4e-16	70.5	Trypsin Inhibitor like cysteine rich domain
4	PF00093 VWC	0.027	26.1	von Willebrand factor type C domain
5	PF00094 VWD	3.7e-83	288.9	von Willebrand factor type D domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000436812

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000407422	0.986	Mucin-7
2	9606.ENSP00000381008	0.982	Mucin-16
3	9606.ENSP00000484824	0.982	Mucin-1
4	9606.ENSP00000416753	0.975	Mucin-15
5	9606.ENSP00000441929	0.975	Mucin-12
6	9606.ENSP00000485028	0.974	Mucin-13
7	9606.ENSP00000246895	0.973	Statherin
8	9606.ENSP00000302716	0.971	Mucin-17
9	9606.ENSP00000368771	0.971	Mucin-3A
10	9606.ENSP00000414350	0.971	Mucin-20
11	9606.ENSP00000365473	0.964	Mucin-21
12	9606.ENSP00000417498	0.946	Mucin-4
13	9606.ENSP00000485659	0.941	Mucin-5AC
14	9606.ENSP00000444171	0.935	Polypeptide N-acetylgalactosaminyltransferase 6
15	9606.ENSP00000379377	0.932	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 3
16	9606.ENSP00000389176	0.932	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
17	9606.ENSP00000262915	0.930	ST3 beta-galactoside alpha-2,3-sialyltransferase 3
18	9606.ENSP00000406861	0.929	Mucin-6
19	9606.ENSP00000317027	0.926	Beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase 4
20	9606.ENSP00000484640	0.923	Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.811	response to stimulus
GO:0009987	0.718	cellular process
GO:0065007	0.604	biological regulation
GO:0050789	0.519	regulation of biological process
GO:0050794	0.502	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.997	extracellular region
GO:0043226	0.992	organelle
GO:0012505	0.992	endomembrane system
GO:0005737	0.991	cytoplasm
GO:0005794	0.981	Golgi apparatus
GO:0005615	0.976	extracellular space
GO:0016020	0.954	membrane
GO:0005796	0.896	Golgi lumen
GO:0071944	0.832	cell periphery
GO:0005886	0.725	plasma membrane
GO:0065010	0.619	extracellular membrane-bounded organelle
GO:1903561	0.585	extracellular vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]