StarFunc result for job id Q9HC96

User Input

>input (672 residues)
MRAGRGATPARELFRDAAFPAADSSLFCDLSTPLAQFREDITWRRPQEICATPRLFPDDP
REGQVKQGLLGDCWFLCACAALQKSRHLLDQVIPPGQPSWADQEYRGSFTCRIWQFGRWV
EVTTDDRLPCLAGRLCFSRCQREDVFWLPLLEKVYAKVHGSYEHLWAGQVADALVDLTGG
LAERWNLKGVAGSGGQQDRPGRWEHRTCRQLLHLKDQCLISCCVLSPRAGARELGEFHAF
IVSDLRELQGQAGQCILLLRIQNPWGRRCWQGLWREGGEGWSQVDAAVASELLSQLQEGE
FWVEEEEFLREFDELTVGYPVTEAGHLQSLYTERLLCHTRALPGAWVKGQSAGGCRNNSG
FPSNPKFWLRVSEPSEVYIAVLQRSRLHAADWAGRARALVGDSHTSWSPASIPGKHYQAV
GLHLWKVEKRRVNLPRVLSMPPVAGTACHAYDREVHLRCELSPGYYLAVPSTFLKDAPGE
FLLRVFSTGRVSLSAIRAVAKNTTPGAALPAGEWGTVQLRGSWRVGQTAGGSRNFASYPT
NPCFPFSVPEGPGPRCVRITLHQHCRPSDTEFHPIGFHIFQVPEGGRSQDAPPLLLQEPL
LSCVPHRYAQEVSRLCLLPAGTYKVVPSTYLPDTEGAFTVTIATRIDRPSIHSQEMLGQF
LQEVSIMAVMKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ES66	0.710	0.716	0.000	666	0.808	0.815	Q9ES66.pdb.gz	CAN10_RAT Calpain-10 OS=Rattus norvegicus OX=10116 GN=Capn10 PE=2 SV=1
2	AFDB:Q9HC96	1.000	1.000	0.000	672	1.000	1.000	Q9HC96.pdb.gz	CAN10_HUMAN Calpain-10 OS=Homo sapiens OX=9606 GN=CAPN10 PE=1 SV=2
3	AFDB:Q22036	0.590	0.611	2.000E-40	648	0.249	0.258	Q22036.pdb.gz	CAN5_CAEEL Calpain-5 OS=Caenorhabditis elegans OX=6239 GN=tra-3 PE=1 SV=1
4	AFDB:B8A6G0	0.590	0.565	3.052E-40	704	0.225	0.214	B8A6G0.pdb.gz	B8A6G0_DANRE Calpain 1, (mu/I) large subunit a OS=Danio rerio OX=7955 GN=capn1 PE=1 SV=1
5	AFDB:Q9VT65	0.581	0.430	5.751E-40	925	0.225	0.163	Q9VT65.pdb.gz	CANB_DROME Calpain-B OS=Drosophila melanogaster OX=7227 GN=CalpB PE=1 SV=2
6	AFDB:Q11002	0.589	0.482	9.751E-40	828	0.220	0.179	Q11002.pdb.gz	CANA_DROME Calpain-A OS=Drosophila melanogaster OX=7227 GN=CalpA PE=1 SV=2
7	AFDB:Q91VA3	0.591	0.567	1.204E-39	703	0.220	0.211	Q91VA3.pdb.gz	CAN8_MOUSE Calpain-8 OS=Mus musculus OX=10090 GN=Capn8 PE=1 SV=1
8	AFDB:P34308	0.587	0.510	1.653E-39	780	0.228	0.196	P34308.pdb.gz	CAN_CAEEL Calpain clp-1 OS=Caenorhabditis elegans OX=6239 GN=clp-1 PE=2 SV=4
9	AFDB:O35350	0.596	0.563	2.270E-39	713	0.235	0.222	O35350.pdb.gz	CAN1_MOUSE Calpain-1 catalytic subunit OS=Mus musculus OX=10090 GN=Capn1 PE=1 SV=1
10	AFDB:Q9UMQ6	0.584	0.534	2.523E-39	739	0.237	0.215	Q9UMQ6.pdb.gz	CAN11_HUMAN Calpain-11 OS=Homo sapiens OX=9606 GN=CAPN11 PE=2 SV=2
11	PDB:1kfuL	0.551	0.532	2.906E-33	699	0.213	0.205	1kfuL.pdb.gz
12	PDB:1kfxL	0.520	0.545	4.429E-28	640	0.198	0.208	1kfxL.pdb.gz
13	PDB:6vlsD	0.114	0.084	1.793E-3	963	0.067	0.047	6vlsD.pdb.gz
14	PDB:2vvfA	0.108	0.201	7.867E-3	269	0.039	0.097	2vvfA.pdb.gz	Insights Into Virus Evolution and Membrane Biogenesis from the Structure of the Marine Lipid-Containing Bacteriophage Pm2.
15	PDB:3am2A	0.122	0.257	8.743E-3	286	0.028	0.066	3am2A.pdb.gz
16	PDB:7kveB	0.105	0.060	1.831E-2	1374	0.064	0.031	7kveB.pdb.gz
17	PDB:4nhyA	0.089	0.119	2.035E-2	461	0.046	0.067	4nhyA.pdb.gz	Structure of the Ribosomal Oxygenase OGFOD1 Provides Insights into the Regio- and Stereoselectivity of Prolyl Hydroxylases.
18	PDB:6l4cC	0.090	0.149	2.650E-2	353	0.046	0.088	6l4cC.pdb.gz	Comparative study of 7S globulin from Corylus avellana and Solanum lycopersicum revealed importance of salicylic acid and Cu-binding loop in modulating their function.
19	PDB:4zelA	0.127	0.147	2.945E-2	550	0.070	0.085	4zelA.pdb.gz	The crystal structure of human dopamine beta-hydroxylase at 2.9 angstrom resolution.
20	PDB:4uflA	0.106	0.110	3.451E-2	641	0.055	0.058	4uflA.pdb.gz	Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9ES66	0.0	1091	666	0.810	0.817	CAN10_RAT Calpain-10 OS=Rattus norvegicus OX=10116 GN=Capn10 PE=2 SV=1
2	Q9ESK3	0.0	1095	666	0.811	0.818	CAN10_MOUSE Calpain-10 OS=Mus musculus OX=10090 GN=Capn10 PE=2 SV=2
3	Q9HC96	0.0	1372	672	1.000	1.000	CAN10_HUMAN Calpain-10 OS=Homo sapiens OX=9606 GN=CAPN10 PE=1 SV=2
4	Q9UMQ6	8.13e-69	241	739	0.249	0.226	CAN11_HUMAN Calpain-11 OS=Homo sapiens OX=9606 GN=CAPN11 PE=2 SV=2
5	P97571	8.94e-65	229	713	0.237	0.223	CAN1_RAT Calpain-1 catalytic subunit OS=Rattus norvegicus OX=10116 GN=Capn1 PE=1 SV=1
6	O08688	2.11e-64	226	640	0.246	0.258	CAN5_MOUSE Calpain-5 OS=Mus musculus OX=10090 GN=Capn5 PE=1 SV=1
7	P35750	5.09e-64	227	714	0.235	0.221	CAN1_PIG Calpain-1 catalytic subunit OS=Sus scrofa OX=9823 GN=CAPN1 PE=2 SV=3
8	O35350	5.94e-64	227	713	0.238	0.224	CAN1_MOUSE Calpain-1 catalytic subunit OS=Mus musculus OX=10090 GN=Capn1 PE=1 SV=1
9	Q7SYA9	2.50e-63	225	704	0.235	0.224	Q7SYA9_DANRE Calpain 1, (Mu/I) large subunit a OS=Danio rerio OX=7955 GN=zgc:63788 PE=1 SV=1
10	F1MQD1	2.95e-63	223	640	0.241	0.253	F1MQD1_BOVIN Calpain 5 OS=Bos taurus OX=9913 GN=CAPN5 PE=3 SV=2
11	O15484	3.08e-63	223	640	0.235	0.247	CAN5_HUMAN Calpain-5 OS=Homo sapiens OX=9606 GN=CAPN5 PE=1 SV=2
12	B8A6G0	3.70e-63	224	704	0.237	0.226	B8A6G0_DANRE Calpain 1, (mu/I) large subunit a OS=Danio rerio OX=7955 GN=capn1 PE=1 SV=1
13	Q8R4C0	2.24e-62	221	640	0.235	0.247	CAN5_RAT Calpain-5 OS=Rattus norvegicus OX=10116 GN=Capn5 PE=1 SV=1
14	P07384	3.91e-62	222	714	0.237	0.223	CAN1_HUMAN Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1
15	O08529	4.37e-62	221	700	0.235	0.226	CAN2_MOUSE Calpain-2 catalytic subunit OS=Mus musculus OX=10090 GN=Capn2 PE=1 SV=4
16	Q91VA3	4.98e-61	218	703	0.225	0.215	CAN8_MOUSE Calpain-8 OS=Mus musculus OX=10090 GN=Capn8 PE=1 SV=1
17	P20807	2.69e-60	218	821	0.254	0.208	CAN3_HUMAN Calpain-3 OS=Homo sapiens OX=9606 GN=CAPN3 PE=1 SV=2
18	Q07009	2.94e-60	216	700	0.232	0.223	CAN2_RAT Calpain-2 catalytic subunit OS=Rattus norvegicus OX=10116 GN=Capn2 PE=1 SV=3
19	P17655	1.42e-59	214	700	0.232	0.223	CAN2_HUMAN Calpain-2 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN2 PE=1 SV=6
20	B6V3H8	2.37e-58	211	700	0.231	0.221	B6V3H8_CHICK Calpain-2 catalytic subunit OS=Gallus gallus OX=9031 GN=CAPN2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01067 Calpain_III	2.9e-34	129.8	Calpain large subunit, domain III
2	PF00648 Peptidase_C2	8.8e-74	259.8	Calpain family cysteine protease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375844

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000246533	0.834	Calpain small subunit 1
2	9606.ENSP00000379157	0.776	Calpastatin
3	9606.ENSP00000270357	0.773	Aminopeptidase RNPEPL1
4	9606.ENSP00000358404	0.767	Transcription factor 7-like 2
5	9606.ENSP00000295640	0.740	Aminopeptidase B
6	9606.ENSP00000411788	0.739	G-protein coupled receptor 35
7	9606.ENSP00000400882	0.716	Calpain small subunit 2
8	9606.ENSP00000438388	0.690	Kinesin-like protein KIF1A
9	9606.ENSP00000345708	0.681	ATP-sensitive inward rectifier potassium channel 11
10	9606.ENSP00000320935	0.616	Solute carrier family 2, facilitated glucose transporter member 4
11	9606.ENSP00000274695	0.611	Threonylcarbamoyladenosine tRNA methylthiotransferase
12	9606.ENSP00000371634	0.601	Insulin-like growth factor 2 mRNA-binding protein 2
13	9606.ENSP00000287820	0.589	Peroxisome proliferator-activated receptor gamma
14	9606.ENSP00000380432	0.564	Insulin
15	9606.ENSP00000415011	0.563	Zinc transporter 8
16	9606.ENSP00000282728	0.559	Hematopoietically-expressed homeobox protein HHEX
17	9606.ENSP00000418823	0.556	Alpha-ketoglutarate-dependent dioxygenase FTO
18	9606.ENSP00000337473	0.545	Zinc finger protein 324B
19	9606.ENSP00000470498	0.539	Fibrillin-3
20	9606.ENSP00000480405	0.539	G-protein coupled receptor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004198	1.000	calcium-dependent cysteine-type endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0008152	0.977	metabolic process
GO:0051049	0.976	regulation of transport
GO:0051716	0.969	cellular response to stimulus
GO:0016043	0.965	cellular component organization
GO:0071704	0.964	organic substance metabolic process
GO:0051050	0.949	positive regulation of transport
GO:0044238	0.931	primary metabolic process
GO:0034762	0.928	regulation of transmembrane transport
GO:0048522	0.915	positive regulation of cellular process
GO:0070887	0.900	cellular response to chemical stimulus
GO:0010243	0.896	response to organonitrogen compound
GO:0010827	0.893	regulation of glucose transmembrane transport
GO:1901701	0.882	cellular response to oxygen-containing compound
GO:0006807	0.866	nitrogen compound metabolic process
GO:0060341	0.866	regulation of cellular localization
GO:0043170	0.856	macromolecule metabolic process
GO:1901653	0.850	cellular response to peptide
GO:0032868	0.847	response to insulin
GO:0032869	0.831	cellular response to insulin stimulus
GO:0010817	0.825	regulation of hormone levels
GO:0022411	0.808	cellular component disassembly
GO:0046324	0.777	regulation of glucose import
GO:0008219	0.769	cell death
GO:0034764	0.765	positive regulation of transmembrane transport
GO:0051046	0.758	regulation of secretion
GO:1901564	0.757	organonitrogen compound metabolic process
GO:0010828	0.753	positive regulation of glucose transmembrane transport
GO:0046326	0.744	positive regulation of glucose import
GO:0051223	0.731	regulation of protein transport
GO:0019538	0.693	protein metabolic process
GO:0023051	0.692	regulation of signaling
GO:0010646	0.688	regulation of cell communication
GO:0002791	0.680	regulation of peptide secretion
GO:1903530	0.656	regulation of secretion by cell
GO:1904019	0.629	epithelial cell apoptotic process
GO:0090276	0.609	regulation of peptide hormone secretion
GO:1904951	0.519	positive regulation of establishment of protein localization
GO:0051047	0.515	positive regulation of secretion
GO:0051222	0.491	positive regulation of protein transport
GO:0030036	0.472	actin cytoskeleton organization
GO:0050708	0.451	regulation of protein secretion
GO:0002793	0.447	positive regulation of peptide secretion
GO:0044237	0.444	cellular metabolic process
GO:0023056	0.421	positive regulation of signaling
GO:0010647	0.421	positive regulation of cell communication
GO:0050796	0.413	regulation of insulin secretion
GO:1903532	0.399	positive regulation of secretion by cell
GO:0046887	0.369	positive regulation of hormone secretion
GO:0097194	0.350	execution phase of apoptosis
GO:0032502	0.328	developmental process
GO:0006508	0.319	proteolysis
GO:0048519	0.306	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005829	0.996	cytosol
GO:0005739	0.988	mitochondrion
GO:0016020	0.967	membrane
GO:0043228	0.658	non-membrane-bounded organelle
GO:0043232	0.634	intracellular non-membrane-bounded organelle
GO:0031974	0.583	membrane-enclosed lumen
GO:0043233	0.566	organelle lumen
GO:0070013	0.564	intracellular organelle lumen
GO:0071944	0.562	cell periphery
GO:0005886	0.485	plasma membrane
GO:0031981	0.434	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.22.-	1.000	Cysteine endopeptidases.

[back to server]