StarFunc result for job id Q9HCC0

User Input

>input (563 residues)
MWAVLRLALRPCARASPAGPRAYHGDSVASLGTQPDLGSALYQENYKQMKALVNQLHERV
EHIKLGGGEKARALHISRGKLLPRERIDNLIDPGSPFLELSQFAGYQLYDNEEVPGGGII
TGIGRVSGVECMIIANDATVKGGAYYPVTVKKQLRAQEIAMQNRLPCIYLVDSGGAYLPR
QADVFPDRDHFGRTFYNQAIMSSKNIAQIAVVMGSCTAGGAYVPAMADENIIVRKQGTIF
LAGPPLVKAATGEEVSAEDLGGADLHCRKSGVSDHWALDDHHALHLTRKVVRNLNYQKKL
DVTIEPSEEPLFPADELYGIVGANLKRSFDVREVIARIVDGSRFTEFKAFYGDTLVTGFA
RIFGYPVGIVGNNGVLFSESAKKGTHFVQLCCQRNIPLLFLQNITGFMVGREYEAEGIAK
DGAKMVAAVACAQVPKITLIIGGSYGAGNYGMCGRAYSPRFLYIWPNARISVMGGEQAAN
VLATITKDQRAREGKQFSSADEAALKEPIIKKFEEEGNPYYSSARVWDDGIIDPADTRLV
LGLSFSAALNAPIEKTDFGIFRM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VK29	0.986	0.986	0.000	563	1.000	1.000	A0A140VK29.pdb.gz	A0A140VK29_HUMAN methylcrotonoyl-CoA carboxylase OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:Q3ULD5	0.974	0.974	0.000	563	0.888	0.888	Q3ULD5.pdb.gz	MCCB_MOUSE Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Mccc2 PE=1 SV=1
3	AFDB:Q9V9A7	0.952	0.927	4.994E-91	578	0.682	0.664	Q9V9A7.pdb.gz	MCCB_DROME Probable methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Mccc2 PE=2 SV=1
4	AFDB:P34385	0.951	0.882	1.798E-90	608	0.623	0.577	P34385.pdb.gz	MCCB_CAEEL Probable methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=F02A9.10 PE=3 SV=1
5	AFDB:Q9I297	0.943	0.992	2.855E-88	535	0.622	0.654	Q9I297.pdb.gz	Q9I297_PSEAE Methylcrotonyl-CoA carboxylase, beta-subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=liuB PE=1 SV=1
6	AFDB:O06165	0.920	0.979	1.257E-83	529	0.604	0.643	O06165.pdb.gz	O06165_MYCTO Propionyl-CoA carboxylase, beta subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pccB-3 PE=3 SV=1
7	AFDB:Q385A6	0.916	0.844	6.931E-82	612	0.583	0.536	Q385A6.pdb.gz	Q385A6_TRYB2 methylcrotonoyl-CoA carboxylase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4480 PE=3 SV=1
8	PDB:3u9sF	0.933	0.978	7.336E-82	537	0.620	0.650	3u9sF.pdb.gz	An unanticipated architecture of the 750-kDa {alpha}6{beta}6 holoenzyme of 3-methylcrotonyl-CoA carboxylase
9	AFDB:C8VAZ1	0.908	0.870	2.949E-81	588	0.590	0.565	C8VAZ1.pdb.gz	C8VAZ1_EMENI methylcrotonoyl-CoA carboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04687 PE=3 SV=1
10	AFDB:Q9LDD8	0.473	0.454	7.439E-77	587	0.597	0.572	Q9LDD8.pdb.gz	MCCB_ARATH Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MCCB PE=2 SV=1
11	AFDB:O86318	0.921	0.980	6.641E-74	529	0.467	0.497	O86318.pdb.gz	ACCD2_MYCTU Probable biotin-dependent acyl-coenzyme A carboxylase beta2 subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=accD2 PE=1 SV=1
12	PDB:3u9tB	0.765	0.982	2.373E-61	437	0.501	0.645	3u9tB.pdb.gz
13	PDB:5iklB	0.856	0.935	3.705E-61	514	0.400	0.438	5iklB.pdb.gz
14	PDB:3n6rB	0.389	0.431	2.811E-38	506	0.295	0.328	3n6rB.pdb.gz	Crystal structure of the alpha(6)beta(6) holoenzyme of propionyl-coenzyme A carboxylase.
15	PDB:2a7sA	0.388	0.411	6.480E-38	529	0.274	0.291	2a7sA.pdb.gz
16	PDB:4rcnA	0.357	0.213	2.118E-32	972	0.229	0.133	4rcnA.pdb.gz
17	PDB:4rcnB	0.384	0.222	3.697E-32	1000	0.229	0.129	4rcnB.pdb.gz
18	PDB:4g2rB	0.374	0.470	1.065E-31	441	0.243	0.311	4g2rB.pdb.gz	Structure, Activity, and Inhibition of the Carboxyltransferase beta-Subunit of Acetyl Coenzyme A Carboxylase (AccD6) from Mycobacterium tuberculosis.
19	PDB:4l6wB	0.376	0.498	1.380E-30	419	0.224	0.301	4l6wB.pdb.gz
20	PDB:5cskB	0.358	0.107	7.858E-22	2017	0.192	0.054	5cskB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VK29	0.0	1162	563	1.000	1.000	A0A140VK29_HUMAN methylcrotonoyl-CoA carboxylase OS=Homo sapiens OX=9606 PE=2 SV=1
2	C8VAZ1	0.0	666	588	0.597	0.571	C8VAZ1_EMENI methylcrotonoyl-CoA carboxylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04687 PE=3 SV=1
3	D6RDF7	0.0	689	357	0.591	0.933	D6RDF7_HUMAN methylcrotonoyl-CoA carboxylase OS=Homo sapiens OX=9606 GN=MCCC2 PE=1 SV=3
4	O06165	0.0	706	529	0.599	0.637	O06165_MYCTO Propionyl-CoA carboxylase, beta subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pccB-3 PE=3 SV=1
5	P34385	0.0	746	608	0.623	0.577	MCCB_CAEEL Probable methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=F02A9.10 PE=3 SV=1
6	Q385A6	0.0	643	612	0.584	0.538	Q385A6_TRYB2 methylcrotonoyl-CoA carboxylase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4480 PE=3 SV=1
7	Q3ULD5	0.0	1052	563	0.888	0.888	MCCB_MOUSE Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Mus musculus OX=10090 GN=Mccc2 PE=1 SV=1
8	Q5XIT9	0.0	1051	563	0.883	0.883	MCCB_RAT Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Rattus norvegicus OX=10116 GN=Mccc2 PE=2 SV=1
9	Q9HCC0	0.0	1162	563	1.000	1.000	MCCB_HUMAN Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=MCCC2 PE=1 SV=1
10	Q9I297	0.0	717	535	0.622	0.654	Q9I297_PSEAE Methylcrotonyl-CoA carboxylase, beta-subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=liuB PE=1 SV=1
11	Q9LDD8	0.0	660	587	0.597	0.572	MCCB_ARATH Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MCCB PE=2 SV=1
12	Q9V9A7	0.0	793	578	0.684	0.666	MCCB_DROME Probable methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Mccc2 PE=2 SV=1
13	O86318	6.75e-172	499	529	0.467	0.497	ACCD2_MYCTU Probable biotin-dependent acyl-coenzyme A carboxylase beta2 subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=accD2 PE=1 SV=1
14	Q9HZV9	6.73e-151	446	538	0.432	0.452	Q9HZV9_PSEAE Geranyl-CoA carboxylase, beta-subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=atuC PE=1 SV=1
15	Q168G2	1.14e-79	261	510	0.304	0.335	PCCB_ROSDO Propionyl-CoA carboxylase beta chain OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) OX=375451 GN=pccB PE=1 SV=1
16	I3R7F1	1.61e-78	258	516	0.298	0.326	PCCB_HALMT Propionyl-CoA carboxylase, carboxyltransferase subunit OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) OX=523841 GN=pccB PE=1 SV=1
17	D6RD67	2.09e-75	236	115	0.197	0.965	D6RD67_HUMAN methylcrotonoyl-CoA carboxylase (Fragment) OS=Homo sapiens OX=9606 GN=MCCC2 PE=1 SV=3
18	Q5LUG0	4.65e-75	249	510	0.306	0.337	Q5LUG0_RUEPO Propionyl-CoA carboxylase, beta subunit OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) OX=246200 GN=pccB PE=1 SV=1
19	P9WQH7	1.70e-68	233	548	0.300	0.308	ACCD5_MYCTU Biotin-dependent acetyl-/propionyl-coenzyme A carboxylase beta5 subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=accD5 PE=1 SV=1
20	P79384	2.08e-68	232	539	0.309	0.323	PCCB_PIG Propionyl-CoA carboxylase beta chain, mitochondrial OS=Sus scrofa OX=9823 GN=PCCB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01039 Carboxyl_trans	2.4e-149	509.8	Carboxyl transferase domain
2	PF06833 MdcE	2.5e+02	12.5	Malonate decarboxylase gamma subunit (MdcE)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343657

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265594	0.999	Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial
2	9606.ENSP00000418397	0.993	Isovaleryl-CoA dehydrogenase, mitochondrial
3	9606.ENSP00000357535	0.979	Enoyl-CoA hydratase, mitochondrial
4	9606.ENSP00000365462	0.979	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA (PubMed:8434582, PubMed:6765947, PubMed:10101253). Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, [...]
5	9606.ENSP00000382071	0.962	Biotin--protein ligase
6	9606.ENSP00000364883	0.960	Methylglutaconyl-CoA hydratase, mitochondrial
7	9606.ENSP00000370023	0.941	Trifunctional enzyme subunit alpha, mitochondrial
8	9606.ENSP00000252597	0.920	Usher syndrome type-1C protein-binding protein 1
9	9606.ENSP00000231887	0.919	Peroxisomal bifunctional enzyme
10	9606.ENSP00000386227	0.905	Colorectal mutant cancer protein
11	9606.ENSP00000318351	0.898	2-oxoisovalerate dehydrogenase subunit beta, mitochondrial
12	9606.ENSP00000474560	0.871	Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial
13	9606.ENSP00000265395	0.853	3-hydroxyisobutyrate dehydrogenase, mitochondrial
14	9606.ENSP00000377532	0.793	Pyruvate carboxylase, mitochondrial
15	9606.ENSP00000341483	0.792	Ran-binding protein 3
16	9606.ENSP00000363614	0.789	Hydroxymethylglutaryl-CoA lyase, mitochondrial
17	9606.ENSP00000400995	0.766	Biotinidase
18	9606.ENSP00000233710	0.745	Long-chain specific acyl-CoA dehydrogenase, mitochondrial
19	9606.ENSP00000264669	0.733	FAST kinase domain-containing protein 3, mitochondrial
20	9606.ENSP00000221418	0.732	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016421	1.000	CoA carboxylase activity
GO:0005515	0.997	protein binding
GO:0004485	0.659	methylcrotonoyl-CoA carboxylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044281	0.996	small molecule metabolic process
GO:0044237	0.995	cellular metabolic process
GO:1901564	0.995	organonitrogen compound metabolic process
GO:0044238	0.994	primary metabolic process
GO:0044248	0.946	cellular catabolic process
GO:0009083	0.943	branched-chain amino acid catabolic process
GO:1901606	0.868	alpha-amino acid catabolic process
GO:0006551	0.830	leucine metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.953	intracellular organelle lumen
GO:0032991	0.741	protein-containing complex
GO:0005759	0.738	mitochondrial matrix
GO:0005829	0.664	cytosol
GO:0098798	0.401	mitochondrial protein-containing complex
GO:1902494	0.304	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.4.-.-	1.000	Forming carbon-carbon bonds.
RHEA:13589	0.659	3-methyl-(2E)-butenoyl-CoA + ATP + hydrogencarbonate = 3-methyl-(2E)-glutaconyl-CoA + ADP + H(+) + phosphate
EC:6.4.1.4	0.659	methylcrotonoyl-CoA carboxylase.

[back to server]