StarFunc result for job id Q9HCC6

User Input

>input (221 residues)
MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKSSKPVMEKRRRARINESLAQLKTL
ILDALRKESSRHSKLEKADILEMTVRHLRSLRRVQVTAALSADPAVLGKYRAGFHECLAE
VNRFLAGCEGVPADVRSRLLGHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLP
SLGGPFPLLAPPLLPGLTRALPAAPRAGPQGPGGPWRPWLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HCC6	1.000	1.000	2.103E-29	221	1.000	1.000	Q9HCC6.pdb.gz	HES4_HUMAN Transcription factor HES-4 OS=Homo sapiens OX=9606 GN=HES4 PE=1 SV=1
2	AFDB:O57337	0.529	0.418	2.116E-16	290	0.588	0.448	O57337.pdb.gz	HES1_CHICK Transcription factor HES-1 OS=Gallus gallus OX=9031 GN=HES1 PE=2 SV=1
3	AFDB:P35428	0.493	0.405	2.247E-16	282	0.575	0.450	P35428.pdb.gz	HES1_MOUSE Transcription factor HES-1 OS=Mus musculus OX=10090 GN=Hes1 PE=1 SV=1
4	AFDB:Q90Z12	0.517	0.425	5.195E-16	281	0.611	0.480	Q90Z12.pdb.gz	HES4A_XENLA Transcription factor HES-4-A OS=Xenopus laevis OX=8355 GN=hes4-a PE=1 SV=2
5	AFDB:Q6IRB2	0.480	0.413	7.900E-16	267	0.566	0.468	Q6IRB2.pdb.gz	HES1A_XENLA Transcription factor HES-1-A OS=Xenopus laevis OX=8355 GN=hes1-a PE=1 SV=1
6	AFDB:Q90468	0.367	0.256	1.132E-15	334	0.529	0.350	Q90468.pdb.gz
7	AFDB:A7MCR9	0.393	0.309	6.424E-15	291	0.575	0.436	A7MCR9.pdb.gz
8	AFDB:Q26263	0.363	0.193	1.544E-11	435	0.371	0.189	Q26263.pdb.gz	DPN_DROME Protein deadpan OS=Drosophila melanogaster OX=7227 GN=dpn PE=1 SV=2
9	AFDB:F1QI81	0.329	0.329	8.300E-9	221	0.335	0.335	F1QI81.pdb.gz	F1QI81_DANRE Hairy-related 8a OS=Danio rerio OX=7955 GN=her-8a PE=4 SV=2
10	AFDB:P14003	0.349	0.237	1.808E-8	337	0.339	0.223	P14003.pdb.gz	HAIR_DROME Protein hairy OS=Drosophila melanogaster OX=7227 GN=hry PE=1 SV=2
11	PDB:7msmx	0.173	0.079	1.840	553	0.054	0.022	7msmx.pdb.gz	Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
12	PDB:2dc3A	0.165	0.193	2.799	172	0.100	0.128	2dc3A.pdb.gz	High-resolution structure of human cytoglobin: identification of extra N- and C-termini and a new dimerization mode.
13	PDB:6edtD	0.187	0.038	2.799	1270	0.063	0.011	6edtD.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
14	PDB:2p22C	0.180	0.209	2.971	186	0.090	0.108	2p22C.pdb.gz
15	PDB:7egmH	0.141	0.086	2.971	388	0.104	0.059	7egmH.pdb.gz
16	PDB:3v0aB	0.181	0.042	3.155	1150	0.032	0.006	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
17	PDB:2uwjE	0.212	0.556	3.349	70	0.068	0.214	2uwjE.pdb.gz
18	PDB:5imjA	0.205	0.187	3.775	246	0.036	0.033	5imjA.pdb.gz
19	PDB:5hbuB	0.168	0.185	4.008	196	0.081	0.092	5hbuB.pdb.gz	Structures of the nucleoid occlusion protein SlmA bound to DNA and the C-terminal domain of the cytoskeletal protein FtsZ.
20	PDB:6s7oH	0.162	0.296	4.518	108	0.050	0.102	6s7oH.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HCC6	9.05e-154	427	221	1.000	1.000	HES4_HUMAN Transcription factor HES-4 OS=Homo sapiens OX=9606 GN=HES4 PE=1 SV=1
2	Q90Z12	8.25e-84	252	281	0.624	0.491	HES4A_XENLA Transcription factor HES-4-A OS=Xenopus laevis OX=8355 GN=hes4-a PE=1 SV=2
3	Q90VV1	1.07e-83	251	277	0.629	0.502	HES4B_XENLA Transcription factor HES-4-B OS=Xenopus laevis OX=8355 GN=hes4-b PE=1 SV=1
4	Q6XLQ0	7.17e-83	250	290	0.620	0.472	Q6XLQ0_CHICK C-hairy1A OS=Gallus gallus OX=9031 GN=hairy1 PE=1 SV=1
5	O57337	2.93e-82	248	290	0.620	0.472	HES1_CHICK Transcription factor HES-1 OS=Gallus gallus OX=9031 GN=HES1 PE=2 SV=1
6	Q9DF41	1.67e-80	244	291	0.575	0.436	Q9DF41_DANRE BHLH-WRPW transcription factor OS=Danio rerio OX=7955 GN=wu:fc30a03 PE=2 SV=1
7	Q6IRB2	7.59e-80	241	267	0.579	0.479	HES1A_XENLA Transcription factor HES-1-A OS=Xenopus laevis OX=8355 GN=hes1-a PE=1 SV=1
8	Q6PBX3	3.02e-78	238	270	0.606	0.496	Q6PBX3_DANRE Hairy-related 6 OS=Danio rerio OX=7955 GN=HER-6 PE=2 SV=1
9	Q04666	6.75e-78	237	281	0.516	0.406	HES1_RAT Transcription factor HES-1 OS=Rattus norvegicus OX=10116 GN=Hes1 PE=1 SV=1
10	Q14469	6.17e-77	234	280	0.502	0.396	HES1_HUMAN Transcription factor HES-1 OS=Homo sapiens OX=9606 GN=HES1 PE=1 SV=1
11	P35428	7.91e-77	234	282	0.502	0.394	HES1_MOUSE Transcription factor HES-1 OS=Mus musculus OX=10090 GN=Hes1 PE=1 SV=1
12	Q26263	2.56e-42	150	435	0.308	0.156	DPN_DROME Protein deadpan OS=Drosophila melanogaster OX=7227 GN=dpn PE=1 SV=2
13	P14003	4.71e-34	126	337	0.312	0.205	HAIR_DROME Protein hairy OS=Drosophila melanogaster OX=7227 GN=hry PE=1 SV=2
14	P35429	1.14e-27	104	157	0.294	0.414	HES2_RAT Transcription factor HES-2 OS=Rattus norvegicus OX=10116 GN=Hes2 PE=2 SV=1
15	Q9Y543	2.36e-25	99.4	173	0.271	0.347	HES2_HUMAN Transcription factor HES-2 OS=Homo sapiens OX=9606 GN=HES2 PE=2 SV=1
16	Q00P32	2.44e-25	99.8	191	0.262	0.304	HES2_XENLA Transcription factor HES-2 OS=Xenopus laevis OX=8355 GN=hes2 PE=1 SV=2
17	Q6P0J1	2.74e-24	97.8	226	0.226	0.221	Q6P0J1_DANRE Hairy and enhancer of split 6 (Drosophila) OS=Danio rerio OX=7955 GN=her13.2 PE=1 SV=1
18	F1QI81	1.58e-22	93.2	221	0.235	0.235	F1QI81_DANRE Hairy-related 8a OS=Danio rerio OX=7955 GN=her-8a PE=4 SV=2
19	Q01069	5.93e-22	90.9	195	0.303	0.344	ESMB_DROME Enhancer of split mbeta protein OS=Drosophila melanogaster OX=7227 GN=E(spl)mbeta-HLH PE=1 SV=2
20	G3V7S6	3.07e-21	92.0	339	0.253	0.165	G3V7S6_RAT Hes-related family bHLH transcription factor with YRPW motif 2 OS=Rattus norvegicus OX=10116 GN=Hey2 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07527 Hairy_orange	5e-14	63.6	Hairy Orange
2	PF00010 HLH	1.8e-11	55.2	Helix-loop-helix DNA-binding domain
3	PF03666 NPR3	4.3e+02	11.1	Nitrogen Permease regulator of amino acid transport activity 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000060300

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000000150	0.842	Hes family bHLH transcription factor 3
2	9598.ENSPTRP00000044315	0.750	Recombination signal binding protein for immunoglobulin kappa J region
3	9598.ENSPTRP00000012367	0.744	Uncharacterized protein
4	9598.ENSPTRP00000035973	0.744	Transducin-like enhancer of split 4
5	9598.ENSPTRP00000045296	0.744	Uncharacterized protein
6	9598.ENSPTRP00000034843	0.666	Uncharacterized protein
7	9598.ENSPTRP00000005353	0.659	C-terminal binding protein 2
8	9598.ENSPTRP00000004394	0.645	Sirtuin 1
9	9598.ENSPTRP00000030890	0.607	Uncharacterized protein
10	9598.ENSPTRP00000059022	0.575	Notch 4
11	9598.ENSPTRP00000022729	0.573	Delta-like protein
12	9598.ENSPTRP00000005997	0.565	Fanconi anemia, complementation group F
13	9598.ENSPTRP00000035752	0.563	Fanconi anemia, complementation group G
14	9598.ENSPTRP00000014483	0.562	Uncharacterized protein
15	9598.ENSPTRP00000015670	0.554	Signal transducer and activator of transcription
16	9598.ENSPTRP00000036924	0.554	Uncharacterized protein
17	9598.ENSPTRP00000011587	0.553	Delta-like protein
18	9598.ENSPTRP00000053767	0.550	C-terminal binding protein 1
19	9598.ENSPTRP00000018486	0.539	Uncharacterized protein
20	9598.ENSPTRP00000020519	0.531	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.977	DNA binding
GO:0140110	0.947	transcription regulator activity
GO:0043565	0.947	sequence-specific DNA binding
GO:0003690	0.842	double-stranded DNA binding
GO:1990837	0.828	sequence-specific double-stranded DNA binding
GO:0003700	0.755	DNA-binding transcription factor activity
GO:0000981	0.732	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0008134	0.705	transcription factor binding
GO:0140297	0.540	DNA-binding transcription factor binding
GO:0000976	0.503	transcription cis-regulatory region binding
GO:0001227	0.334	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0048523	0.985	negative regulation of cellular process
GO:0006355	0.981	regulation of DNA-templated transcription
GO:0006357	0.972	regulation of transcription by RNA polymerase II
GO:0032502	0.969	developmental process
GO:0009987	0.964	cellular process
GO:0007275	0.949	multicellular organism development
GO:0048731	0.921	system development
GO:0045892	0.919	negative regulation of DNA-templated transcription
GO:0050896	0.893	response to stimulus
GO:0051716	0.855	cellular response to stimulus
GO:0048513	0.707	animal organ development
GO:0000122	0.673	negative regulation of transcription by RNA polymerase II
GO:0009653	0.638	anatomical structure morphogenesis
GO:0045595	0.638	regulation of cell differentiation
GO:0023052	0.629	signaling
GO:0007154	0.628	cell communication
GO:0007165	0.568	signal transduction
GO:0007166	0.559	cell surface receptor signaling pathway
GO:0030154	0.543	cell differentiation
GO:0048518	0.520	positive regulation of biological process
GO:0065009	0.500	regulation of molecular function
GO:0007219	0.463	Notch signaling pathway
GO:0051239	0.453	regulation of multicellular organismal process
GO:0048522	0.440	positive regulation of cellular process
GO:0045596	0.438	negative regulation of cell differentiation
GO:0009888	0.425	tissue development
GO:0009893	0.396	positive regulation of metabolic process
GO:0010604	0.375	positive regulation of macromolecule metabolic process
GO:0031325	0.353	positive regulation of cellular metabolic process
GO:2000026	0.339	regulation of multicellular organismal development
GO:0007399	0.336	nervous system development
GO:0051173	0.334	positive regulation of nitrogen compound metabolic process
GO:0016043	0.331	cellular component organization
GO:0071704	0.329	organic substance metabolic process
GO:0009966	0.305	regulation of signal transduction
GO:0045664	0.302	regulation of neuron differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.687	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]