StarFunc result for job id Q9HCC8

User Input

>input (539 residues)
MAESPGCCSVWARCLHCLYSCHWRKCPRERMQTSKCDCIWFGLLFLTFLLSLSWLYIGLV
LLNDLHNFNEFLFRRWGHWMDWSLAFLLVISLLVTYASLLLVLALLLRLCRQPLHLHSLH
KVLLLLIMLLVAAGLVGLDIQWQQEWHSLRVSLQATAPFLHIGAAAGIALLAWPVADTFY
RIHRRGPKILLLLLFFGVVLVIYLAPLCISSPCIMEPRDLPPKPGLVGHRGAPMLAPENT
LMSLRKTAECGATVFETDVMVSSDGVPFLMHDEHLSRTTNVASVFPTRITAHSSDFSWTE
LKRLNAGSWFLERRPFWGAKPLAGPDQKEAESQTVPALEELLEEAAALNLSIMFDLRRPP
QNHTYYDTFVIQTLETVLNARVPQAMVFWLPDEDRANVQRRAPGMRQIYGRQGGNRTERP
QFLNLPYQDLPLLDIKALHKDNVSVNLFVVNKPWLFSLLWCAGVDSVTTNDCQLLQQMRY
PIWLITPQTYLIIWVITNCVSTMLLLWTFLLQRRFVKKRGKTGLETAVLLTRINNFMME

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ESM6	0.972	0.972	7.019E-81	539	0.848	0.848	Q9ESM6.pdb.gz	GDPD2_MOUSE Glycerophosphoinositol inositolphosphodiesterase GDPD2 OS=Mus musculus OX=10090 GN=Gdpd2 PE=1 SV=1
2	AFDB:E7EY39	0.915	0.847	2.044E-49	584	0.384	0.354	E7EY39.pdb.gz
3	AFDB:Q640M6	0.930	0.829	2.912E-49	607	0.414	0.367	Q640M6.pdb.gz	GDPD5_MOUSE Glycerophosphodiester phosphodiesterase domain-containing protein 5 OS=Mus musculus OX=10090 GN=Gdpd5 PE=1 SV=1
4	AFDB:Q3KTM2	0.929	0.839	7.611E-49	599	0.393	0.354	Q3KTM2.pdb.gz	GDPD5_CHICK Glycerophosphodiester phosphodiesterase domain-containing protein 5 OS=Gallus gallus OX=9031 GN=GDPD5 PE=1 SV=1
5	AFDB:A0A2R8QBH7	0.868	0.757	3.910E-45	621	0.362	0.314	A0A2R8QBH7.pdb.gz
6	AFDB:E9QG52	0.388	0.636	3.708E-21	316	0.241	0.411	E9QG52.pdb.gz
7	AFDB:P10908	0.355	0.725	9.521E-13	247	0.109	0.239	P10908.pdb.gz	UGPQ_ECOLI Glycerophosphodiester phosphodiesterase, cytoplasmic OS=Escherichia coli (strain K12) OX=83333 GN=ugpQ PE=1 SV=1
8	AFDB:Q08959	0.365	0.590	8.372E-12	321	0.111	0.187	Q08959.pdb.gz	PGC1_YEAST Phosphatidylglycerol phospholipase C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PGC1 PE=1 SV=1
9	AFDB:Q9JL55	0.333	0.518	6.326E-11	331	0.121	0.196	Q9JL55.pdb.gz	GDE1_RAT Glycerophosphodiester phosphodiesterase 1 OS=Rattus norvegicus OX=10116 GN=Gde1 PE=1 SV=2
10	AFDB:Q9NZC3	0.339	0.532	9.970E-11	331	0.134	0.218	Q9NZC3.pdb.gz	GDE1_HUMAN Glycerophosphodiester phosphodiesterase 1 OS=Homo sapiens OX=9606 GN=GDE1 PE=1 SV=1
11	PDB:3gfxB	0.173	0.225	9.649E-3	394	0.039	0.053	3gfxB.pdb.gz	Structure and mechanism of a bacterial light-regulated cyclic nucleotide phosphodiesterase.
12	PDB:3gfyB	0.185	0.255	1.123E-2	374	0.045	0.064	3gfyB.pdb.gz	Structure and mechanism of a bacterial light-regulated cyclic nucleotide phosphodiesterase.
13	PDB:5c54A	0.236	0.384	2.167E-2	310	0.063	0.110	5c54A.pdb.gz
14	PDB:4uauA	0.112	0.219	3.778E-2	226	0.058	0.137	4uauA.pdb.gz	Degradation of potent Rubisco inhibitor by selective sugar phosphatase.
15	PDB:4gnkB	0.260	0.190	3.974E-2	769	0.063	0.044	4gnkB.pdb.gz	Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
16	PDB:1vbjA	0.226	0.387	5.383E-2	281	0.054	0.103	1vbjA.pdb.gz	The crystal structure of prostaglandin F synthase from Trypanosoma brucei
17	PDB:1aj0A	0.139	0.210	6.265E-2	282	0.056	0.106	1aj0A.pdb.gz	Crystal structure of the anti-bacterial sulfonamide drug target dihydropteroate synthase.
18	PDB:3k1dA	0.229	0.178	6.589E-2	722	0.065	0.048	3k1dA.pdb.gz
19	PDB:4g9bA	0.111	0.215	6.931E-2	227	0.058	0.137	4g9bA.pdb.gz	Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
20	PDB:3qc3A	0.187	0.337	8.485E-2	225	0.050	0.120	3qc3A.pdb.gz	Crystal structure of a D-ribulose-5-phosphate-3-epimerase (NP_954699) from HOMO SAPIENS at 2.20 A resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9ESM6	0.0	833	539	0.846	0.846	GDPD2_MOUSE Glycerophosphoinositol inositolphosphodiesterase GDPD2 OS=Mus musculus OX=10090 GN=Gdpd2 PE=1 SV=1
2	Q8WTR4	6.97e-145	432	605	0.414	0.369	GDPD5_HUMAN Glycerophosphodiester phosphodiesterase domain-containing protein 5 OS=Homo sapiens OX=9606 GN=GDPD5 PE=1 SV=2
3	Q3KTM2	1.95e-140	420	599	0.388	0.349	GDPD5_CHICK Glycerophosphodiester phosphodiesterase domain-containing protein 5 OS=Gallus gallus OX=9031 GN=GDPD5 PE=1 SV=1
4	Q640M6	3.68e-140	420	607	0.408	0.362	GDPD5_MOUSE Glycerophosphodiester phosphodiesterase domain-containing protein 5 OS=Mus musculus OX=10090 GN=Gdpd5 PE=1 SV=1
5	A0A2R8Q763	9.42e-127	384	579	0.378	0.352	A0A2R8Q763_DANRE Glycerophosphodiester phosphodiesterase domain-containing 5b OS=Danio rerio OX=7955 GN=gdpd5b PE=1 SV=1
6	E7FGJ8	1.82e-119	366	600	0.369	0.332	E7FGJ8_DANRE Glycerophosphodiester phosphodiesterase domain-containing 5a OS=Danio rerio OX=7955 GN=gdpd5a PE=3 SV=2
7	Q9NZC3	1.11e-15	80.5	331	0.089	0.145	GDE1_HUMAN Glycerophosphodiester phosphodiesterase 1 OS=Homo sapiens OX=9606 GN=GDE1 PE=1 SV=1
8	Q9JL56	2.65e-15	79.3	331	0.087	0.142	GDE1_MOUSE Glycerophosphodiester phosphodiesterase 1 OS=Mus musculus OX=10090 GN=Gde1 PE=1 SV=1
9	Q9JL55	3.10e-15	79.3	331	0.087	0.142	GDE1_RAT Glycerophosphodiester phosphodiesterase 1 OS=Rattus norvegicus OX=10116 GN=Gde1 PE=1 SV=2
10	P10908	8.68e-14	73.6	247	0.069	0.150	UGPQ_ECOLI Glycerophosphodiester phosphodiesterase, cytoplasmic OS=Escherichia coli (strain K12) OX=83333 GN=ugpQ PE=1 SV=1
11	Q08959	9.89e-07	53.1	321	0.083	0.140	PGC1_YEAST Phosphatidylglycerol phospholipase C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PGC1 PE=1 SV=1
12	Q9C907	1.00e-06	53.5	392	0.071	0.097	GDPD5_ARATH Glycerophosphodiester phosphodiesterase GDPD5 OS=Arabidopsis thaliana OX=3702 GN=GDPD5 PE=2 SV=1
13	P09394	2.78e-06	52.0	358	0.074	0.112	GLPQ_ECOLI Glycerophosphodiester phosphodiesterase, periplasmic OS=Escherichia coli (strain K12) OX=83333 GN=glpQ PE=1 SV=2
14	Q59S57	4.08e-06	51.6	405	0.056	0.074	Q59S57_CANAL Phosphatidylglycerol phospholipase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C602420WA PE=4 SV=1
15	Q8C0L9	0.003	42.7	675	0.115	0.092	GPCP1_MOUSE Glycerophosphocholine phosphodiesterase GPCPD1 OS=Mus musculus OX=10090 GN=Gpcpd1 PE=1 SV=1
16	Q9C104	0.003	42.7	1076	0.058	0.029	GDE1_SCHPO Glycerophosphocholine phosphodiesterase gde1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gde1 PE=1 SV=1
17	Q8N9F7	0.004	41.6	314	0.061	0.105	GDPD1_HUMAN Lysophospholipase D GDPD1 OS=Homo sapiens OX=9606 GN=GDPD1 PE=1 SV=2
18	Q6P2T3	0.030	39.3	315	0.033	0.057	Q6P2T3_DANRE Glycerophosphodiester phosphodiesterase domain containing 1 like OS=Danio rerio OX=7955 GN=gdpd3 PE=2 SV=1
19	Q9CRY7	0.065	38.1	314	0.056	0.096	GDPD1_MOUSE Lysophospholipase D GDPD1 OS=Mus musculus OX=10090 GN=Gdpd1 PE=1 SV=1
20	Q02979	0.11	37.7	1223	0.037	0.016	GDE1_YEAST Glycerophosphocholine phosphodiesterase GDE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GDE1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03009 GDPD	7.6e-20	83.3	Glycerophosphoryl diester phosphodiesterase family
2	PF13653 GDPD_2	0.01	27.5	Glycerophosphoryl diester phosphodiesterase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003820204.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003832761.1	0.764	Belongs to the FAD-dependent glycerol-3-phosphate dehydrogenase family
2	9597.XP_003817413.1	0.655	Glycerophosphodiester phosphodiesterase domain-containing protein 1 isoform X1
3	9597.XP_003846005.1	0.628	Major facilitator superfamily domain containing 4B
4	9597.XP_003831318.1	0.590	Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family
5	9597.XP_003822035.1	0.583	RAB30, member RAS oncogene family
6	9597.XP_003810030.1	0.569	Ribosomal protein S28
7	9597.XP_003808187.1	0.559	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes
8	9597.XP_008961366.1	0.534	Lysophospholipase II
9	9597.XP_003805875.1	0.518	Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008081	1.000	phosphoric diester hydrolase activity
GO:0005515	0.998	protein binding
GO:0008889	0.478	glycerophosphodiester phosphodiesterase activity
GO:0016298	0.368	lipase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.974	cellular process
GO:0071840	0.955	cellular component organization or biogenesis
GO:0016043	0.951	cellular component organization
GO:0050794	0.926	regulation of cellular process
GO:0050793	0.799	regulation of developmental process
GO:0048522	0.772	positive regulation of cellular process
GO:0045595	0.630	regulation of cell differentiation
GO:0051094	0.585	positive regulation of developmental process
GO:0006996	0.541	organelle organization
GO:0030029	0.532	actin filament-based process
GO:0071704	0.479	organic substance metabolic process
GO:0045597	0.463	positive regulation of cell differentiation
GO:0045667	0.458	regulation of osteoblast differentiation
GO:0030036	0.408	actin cytoskeleton organization
GO:0097435	0.395	supramolecular fiber organization
GO:0007015	0.330	actin filament organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0043226	0.964	organelle
GO:0005622	0.952	intracellular anatomical structure
GO:0043229	0.932	intracellular organelle
GO:0043227	0.800	membrane-bounded organelle
GO:0043232	0.786	intracellular non-membrane-bounded organelle
GO:0005737	0.735	cytoplasm
GO:0043231	0.704	intracellular membrane-bounded organelle
GO:0120025	0.315	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.4.-	1.000	Phosphoric diester hydrolases.
RHEA:12969	0.478	a sn-glycero-3-phosphodiester + H2O = an alcohol + H(+) + sn-glycerol 3-phosphate
EC:3.1.4.46	0.478	glycerophosphodiester phosphodiesterase.

[back to server]