StarFunc result for job id Q9HCC9

User Input

>input (887 residues)
MMNRFRKWLYKPKRSDPQLLARFYYADEELNQVAAELDSLDGRKDPQRCTLLVSQFRSCQ
DNVLNIINQIMDECIPQDRAPRDFCVKFPEEIRHDNLAGQLWFGAECLAAGSIIMNRELE
SMAMRPLAKELTRSLEDVRGALRDQALRDLNTYTEKMREALRHFDVLFAEFELSYVSAMV
PVKSPREYYVQQEVIVLFCETVERALDFGYLTQDMIDDYEPALMFSIPRLAIVCGLVVYA
DGPLNLDRKVEDMSELFRPFHTLLRKIRDLLQTLTEEELHTLERNLCISQDVEFPIRADV
QGPAALAPALSAPLPPEGPLSAKAKDPDAELACSMQYDDQELEQLSRMVHRAGDEMSSLL
SPPIACQSPAHRPGAEGSPGGEASPGRPRLRSGSDEEERVFFMDDVEGTAEALARPESPA
GPFGWAGSTWADPQEKGQGGPGGAAGISLPASEKEEDLSNNNLEAEGTDGASLAGTSSCS
CLDSRLHLDGWEVGADDAETAEMIAHRTGGMKLSATVIFNPKSPTSLDSAVATQEAASEP
VAEGMDGGPHKLSTGATNCLLHSCVCCGSCGDSREDVVERLREKCSPGGVIGASYAAGLA
KASDRAPERQEEAPPPSEDASNGREPKAPTSDKCLPHTSGSQVDTASGLQGEAGVAGQQE
PEARELHAGSPSAHEAPQALSGSSSSTAGSCSSDKMGPEAAPAATHAAPQATREKIRSRF
HGSHDLIHRLFVCISGVADQLQTNYASDLRSILKTLFEVMATKPETDDKEKLRKVTQTLR
SAALEDCALCQETLSSSELAAKTRDGDFEDPPEWVPDEACGFCTACKAPFTVIRRKHHCR
SCGKIFCSRCSSHSAPLPRYGQVKPVRVCTHCYMFHVTPFYSDKAGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HCC9	1.000	1.000	0.000	887	1.000	1.000	Q9HCC9.pdb.gz	LST2_HUMAN Lateral signaling target protein 2 homolog OS=Homo sapiens OX=9606 GN=ZFYVE28 PE=1 SV=3
2	AFDB:A5PMI2	0.074	0.056	3.991E-4	1216	0.103	0.075	A5PMI2.pdb.gz	A5PMI2_DANRE Zinc finger FYVE domain-containing protein 9 isoform X1 OS=Danio rerio OX=7955 GN=zfyve9a PE=4 SV=2
3	AFDB:A2A8R0	0.070	0.045	2.425E-3	1397	0.107	0.068	A2A8R0.pdb.gz	A2A8R0_MOUSE Zinc finger FYVE domain-containing protein OS=Mus musculus OX=10090 GN=Zfyve9 PE=1 SV=1
4	AFDB:Q7K9H6	0.075	0.051	3.419E-3	1343	0.118	0.078	Q7K9H6.pdb.gz	Q7K9H6_DROME Zinc finger FYVE domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Sara PE=1 SV=1
5	AFDB:Q7Z3T8	0.070	0.041	6.799E-3	1539	0.105	0.060	Q7Z3T8.pdb.gz	ZFY16_HUMAN Zinc finger FYVE domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZFYVE16 PE=1 SV=3
6	AFDB:Q92953	0.079	0.077	7.671E-1	911	0.117	0.114	Q92953.pdb.gz	KCNB2_HUMAN Potassium voltage-gated channel subfamily B member 2 OS=Homo sapiens OX=9606 GN=KCNB2 PE=1 SV=2
7	AFDB:Q86IH1	0.058	0.067	8.008E-1	740	0.052	0.062	Q86IH1.pdb.gz	HBX4_DICDI Homeobox protein 4 OS=Dictyostelium discoideum OX=44689 GN=hbx4 PE=3 SV=1
8	PDB:6nr7A	0.082	0.070	1.044	1086	0.068	0.055	6nr7A.pdb.gz	Refined model of chicken vinculin suggests the mechanism of activation by helical super-bundle unfurling
9	AFDB:Q380Z7	0.063	0.038	1.525	2059	0.113	0.049	Q380Z7.pdb.gz	Q380Z7_TRYB2 Flagellar Member 7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8650 PE=4 SV=1
10	PDB:5n2sA	0.078	0.131	1.604	383	0.030	0.070	5n2sA.pdb.gz	Structures of Human A1 and A2A Adenosine Receptors with Xanthines Reveal Determinants of Selectivity.
11	PDB:7wq3R	0.076	0.192	2.076	289	0.046	0.142	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
12	PDB:6wtiC	0.058	0.206	2.362	186	0.017	0.081	6wtiC.pdb.gz	A 'Build and Retrieve' methodology to simultaneously solve cryo-EM structures of membrane proteins.
13	AFDB:O74363	0.049	0.058	2.447	695	0.086	0.109	O74363.pdb.gz	YND2_SCHPO G-patch and R3H domain-containing protein C30B4.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC30B4.02c PE=4 SV=1
14	AFDB:Q700D7	0.041	0.062	2.447	499	0.086	0.152	Q700D7.pdb.gz	Q700D7_ARATH At4g12670 OS=Arabidopsis thaliana OX=3702 GN=At4g12670 PE=1 SV=1
15	PDB:5voxb	0.065	0.070	2.574	634	0.029	0.041	5voxb.pdb.gz
16	PDB:1aroP	0.068	0.076	2.804	774	0.034	0.039	1aroP.pdb.gz
17	PDB:1m56A	0.065	0.094	3.330	547	0.043	0.069	1m56A.pdb.gz	The X-ray crystal structures of wild-type and EQ(I-286) mutant cytochrome c oxidases from Rhodobacter sphaeroides.
18	PDB:5nddA	0.108	0.150	3.330	567	0.037	0.058	5nddA.pdb.gz	Structural insight into allosteric modulation of protease-activated receptor 2.
19	PDB:6xz4A	0.073	0.181	3.330	304	0.034	0.099	6xz4A.pdb.gz
20	PDB:1kqfC	0.063	0.201	3.629	216	0.021	0.088	1kqfC.pdb.gz	Molecular basis of proton motive force generation: structure of formate dehydrogenase-N.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HCC9	0.0	1821	887	1.000	1.000	LST2_HUMAN Lateral signaling target protein 2 homolog OS=Homo sapiens OX=9606 GN=ZFYVE28 PE=1 SV=3
2	Q86P45	7.14e-17	86.7	441	0.042	0.084	Q86P45_DROME SD23787p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CG6001 PE=2 SV=1
3	O13821	1.14e-16	87.0	610	0.039	0.057	VPS27_SCHPO Vacuolar protein sorting-associated protein 27 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sst4 PE=3 SV=1
4	A0A0B4LHR8	3.23e-16	85.9	877	0.042	0.042	A0A0B4LHR8_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG14261 PE=1 SV=1
5	Q8IKN0	4.86e-16	82.4	325	0.038	0.105	Q8IKN0_PLAF7 FYVE and coiled-coil domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1460100 PE=4 SV=1
6	Q8IMP2	5.44e-16	85.1	729	0.042	0.051	Q8IMP2_DROME LD28220p OS=Drosophila melanogaster OX=7227 GN=CG14261 PE=1 SV=1
7	Q9BQ24	2.84e-15	78.6	234	0.037	0.141	ZFY21_HUMAN Zinc finger FYVE domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZFYVE21 PE=1 SV=1
8	Q7Z6J4	1.78e-14	80.1	655	0.046	0.063	FGD2_HUMAN FYVE, RhoGEF and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FGD2 PE=1 SV=1
9	Q8BIJ7	2.28e-14	79.7	712	0.052	0.065	RUFY1_MOUSE RUN and FYVE domain-containing protein 1 OS=Mus musculus OX=10090 GN=Rufy1 PE=1 SV=1
10	Q96T51	4.08e-14	79.0	708	0.060	0.075	RUFY1_HUMAN RUN and FYVE domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RUFY1 PE=1 SV=2
11	A0A0S2Z4Q4	1.24e-13	77.4	699	0.051	0.064	A0A0S2Z4Q4_HUMAN Hepatocyte growth factor-regulated tyrosine kinase substrate (Fragment) OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1
12	P40343	1.26e-13	77.0	622	0.041	0.058	VPS27_YEAST Vacuolar protein sorting-associated protein 27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS27 PE=1 SV=3
13	I3L1P5	1.39e-13	76.6	536	0.051	0.084	I3L1P5_HUMAN Hepatocyte growth factor-regulated tyrosine kinase substrate (Fragment) OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=2
14	Q9JJ50	1.57e-13	77.0	776	0.039	0.045	HGS_RAT Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Rattus norvegicus OX=10116 GN=Hgs PE=1 SV=1
15	A0A0S2Z4R4	1.61e-13	77.0	777	0.051	0.058	A0A0S2Z4R4_HUMAN Hepatocyte growth factor-regulated tyrosine kinase substrate (Fragment) OS=Homo sapiens OX=9606 GN=HGS PE=2 SV=1
16	O14964	1.61e-13	77.0	777	0.051	0.058	HGS_HUMAN Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Homo sapiens OX=9606 GN=HGS PE=1 SV=1
17	Q960V6	1.70e-13	77.4	1343	0.035	0.023	Q960V6_DROME Zinc finger FYVE domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Sara PE=2 SV=1
18	Q99LI8	1.70e-13	77.0	775	0.039	0.045	HGS_MOUSE Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Mus musculus OX=10090 GN=Hgs PE=1 SV=2
19	Q7K9H6	1.82e-13	77.4	1343	0.035	0.023	Q7K9H6_DROME Zinc finger FYVE domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Sara PE=1 SV=1
20	Q0WUR5	3.33e-13	76.6	1757	0.032	0.016	FAB1A_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A OS=Arabidopsis thaliana OX=3702 GN=FAB1A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01363 FYVE	1.1e-15	68.8	FYVE zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000290974

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000275493	0.930	Epidermal growth factor receptor
2	9606.ENSP00000265171	0.926	Pro-epidermal growth factor
3	9606.ENSP00000376345	0.912	Growth factor receptor-bound protein 2
4	9606.ENSP00000387784	0.907	Son of sevenless homolog 1
5	9606.ENSP00000358820	0.709	Epidermal growth factor receptor kinase substrate 8-like protein 3
6	9606.ENSP00000313140	0.704	Exonuclease 3'-5' domain-containing protein 2
7	9606.ENSP00000344488	0.696	Junctophilin-1
8	9606.ENSP00000320416	0.654	Vacuolar protein sorting-associated protein 37D
9	9606.ENSP00000302114	0.647	PRELI domain-containing protein 1, mitochondrial
10	9606.ENSP00000337889	0.634	Max dimerization protein 4
11	9606.ENSP00000281722	0.608	Probable RNA-binding protein 46
12	9606.ENSP00000344828	0.603	Zinc finger protein 678
13	9606.ENSP00000477344	0.593	Synaptotagmin-6
14	9606.ENSP00000360365	0.567	Malignant T-cell-amplified sequence 1
15	9606.ENSP00000005226	0.558	Harmonin
16	9606.ENSP00000411073	0.551	B-cell CLL/lymphoma 7 protein family member B
17	9606.ENSP00000227266	0.521	Dipeptidyl peptidase 1
18	9606.ENSP00000340474	0.518	Exonuclease mut-7 homolog
19	9606.ENSP00000360035	0.514	Protein phosphatase 1 regulatory subunit 3D
20	9606.ENSP00000386711	0.512	Janus kinase and microtubule-interacting protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0032266	1.000	phosphatidylinositol-3-phosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051246	0.987	regulation of protein metabolic process
GO:0001932	0.977	regulation of protein phosphorylation
GO:0048583	0.976	regulation of response to stimulus
GO:0048519	0.973	negative regulation of biological process
GO:0045859	0.973	regulation of protein kinase activity
GO:0050730	0.960	regulation of peptidyl-tyrosine phosphorylation
GO:0009966	0.950	regulation of signal transduction
GO:0048523	0.948	negative regulation of cellular process
GO:0009968	0.944	negative regulation of signal transduction
GO:1901184	0.933	regulation of ERBB signaling pathway
GO:0009892	0.913	negative regulation of metabolic process
GO:0042058	0.901	regulation of epidermal growth factor receptor signaling pathway
GO:0051248	0.888	negative regulation of protein metabolic process
GO:0043086	0.887	negative regulation of catalytic activity
GO:0042326	0.878	negative regulation of phosphorylation
GO:0051348	0.872	negative regulation of transferase activity
GO:0010469	0.835	regulation of signaling receptor activity
GO:0061097	0.824	regulation of protein tyrosine kinase activity
GO:1901185	0.822	negative regulation of ERBB signaling pathway
GO:0042059	0.812	negative regulation of epidermal growth factor receptor signaling pathway
GO:0033673	0.767	negative regulation of kinase activity
GO:0001933	0.752	negative regulation of protein phosphorylation
GO:0050732	0.723	negative regulation of peptidyl-tyrosine phosphorylation
GO:0006469	0.716	negative regulation of protein kinase activity
GO:0009987	0.467	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0098588	0.997	bounding membrane of organelle
GO:0005768	0.997	endosome
GO:0030659	0.996	cytoplasmic vesicle membrane
GO:0005769	0.992	early endosome
GO:0010008	0.992	endosome membrane
GO:0031901	0.979	early endosome membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]