StarFunc result for job id Q9HCD5

User Input

>input (579 residues)
MNTAPSRPSPTRRDPYGFGDSRDSRRDRSPIRGSPRREPRDGRNGRDARDSRDIRDPRDL
RDHRHSRDLRDHRDSRSVRDVRDVRDLRDFRDLRDSRDFRDQRDPMYDRYRDMRDSRDPM
YRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREEL
YRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQ
ALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNE
CREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEET
DKIINYLRERKERLMRSSTDSLPGPISRQPLGATSGASLKTQPSSQPLQSGQVLPSATPT
PSAPPTSQQELQAKILSLFNSGTVTANSSSASPSVAAGNTPNQNFSTAANSQPQQRSQAS
GNQPPSILGQGGSAQNMGPRPGAPSQGLFGQPSSRLAPASNMTSQRPVSSTGINFDNPSV
QKALDTLIQSGPALSHLVSQTTAQMGQPQAPMGSYQRHY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q91W39	0.426	0.426	2.226E-85	579	0.927	0.927	Q91W39.pdb.gz	NCOA5_MOUSE Nuclear receptor coactivator 5 OS=Mus musculus OX=10090 GN=Ncoa5 PE=1 SV=1
2	AFDB:B5X1C7	0.318	0.276	5.612E-42	676	0.461	0.395	B5X1C7.pdb.gz	B5X1C7_SALSA Nuclear receptor coactivator 5 OS=Salmo salar OX=8030 GN=NCOA5 PE=2 SV=1
3	AFDB:Q7KLX0	0.179	0.270	6.770E-18	383	0.130	0.196	Q7KLX0.pdb.gz	Q7KLX0_DROME HL05936p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Neos PE=2 SV=1
4	AFDB:U6A492	0.173	0.183	4.726E-16	545	0.192	0.204	U6A492.pdb.gz	NCOA5_SCHMD Nuclear receptor coactivator 5 OS=Schmidtea mediterranea OX=79327 GN=NCOA5 PE=1 SV=1
5	PDB:6o76B	0.155	0.195	1.165E-5	451	0.028	0.035	6o76B.pdb.gz
6	PDB:4x5oB	0.149	0.238	1.242E-5	350	0.026	0.043	4x5oB.pdb.gz
7	PDB:4phcA	0.148	0.190	1.935E-5	444	0.026	0.034	4phcA.pdb.gz	Comparison of histidine recognition in human and trypanosomatid histidyl-tRNA synthetases.
8	PDB:3hriF	0.125	0.192	2.340E-5	370	0.033	0.051	3hriF.pdb.gz
9	PDB:1kmmC	0.141	0.206	2.830E-5	387	0.024	0.036	1kmmC.pdb.gz	The first step of aminoacylation at the atomic level in histidyl-tRNA synthetase.
10	PDB:3hriA	0.125	0.178	3.423E-5	401	0.033	0.047	3hriA.pdb.gz
11	PDB:4g85A	0.147	0.196	5.006E-5	427	0.028	0.037	4g85A.pdb.gz
12	PDB:1qf6A	0.150	0.136	5.333E-5	641	0.019	0.017	1qf6A.pdb.gz	The structure of threonyl-tRNA synthetase-tRNA(Thr) complex enlightens its repressor activity and reveals an essential zinc ion in the active site
13	PDB:1httA	0.141	0.216	5.682E-5	366	0.024	0.038	1httA.pdb.gz	Crystal structure of histidyl-tRNA synthetase from Escherichia coli complexed with histidyl-adenylate.
14	PDB:4ztuB	0.140	0.215	6.450E-5	363	0.022	0.036	4ztuB.pdb.gz	Structural basis for processivity and antiviral drug toxicity in human mitochondrial DNA replicase
15	AFDB:Q3SXY8	0.098	0.126	1.357E-2	428	0.090	0.121	Q3SXY8.pdb.gz	AR13B_HUMAN ADP-ribosylation factor-like protein 13B OS=Homo sapiens OX=9606 GN=ARL13B PE=1 SV=1
16	AFDB:A0A2R8QDA7	0.072	0.106	1.749E-2	364	0.083	0.132	A0A2R8QDA7.pdb.gz
17	AFDB:F1QWM2	0.057	0.038	2.558E-2	1100	0.133	0.070	F1QWM2.pdb.gz	STYL2_DANRE Serine/threonine/tyrosine-interacting-like protein 2 OS=Danio rerio OX=7955 GN=styxl2 PE=1 SV=1
18	AFDB:A0A2R9YJG3	0.064	0.059	5.135E-2	628	0.155	0.143	A0A2R9YJG3.pdb.gz
19	AFDB:O13682	0.073	0.035	8.526E-2	1288	0.097	0.043	O13682.pdb.gz	SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=swr1 PE=3 SV=1
20	AFDB:Q05BK6	0.053	0.073	1.031E-1	366	0.090	0.142	Q05BK6.pdb.gz	Q05BK6_HUMAN TFG protein OS=Homo sapiens OX=9606 GN=TFG PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q91W39	0.0	924	579	0.927	0.927	NCOA5_MOUSE Nuclear receptor coactivator 5 OS=Mus musculus OX=10090 GN=Ncoa5 PE=1 SV=1
2	Q9HCD5	0.0	1170	579	1.000	1.000	NCOA5_HUMAN Nuclear receptor coactivator 5 OS=Homo sapiens OX=9606 GN=NCOA5 PE=1 SV=2
3	B5X221	2.32e-134	405	582	0.475	0.473	B5X221_SALSA Nuclear receptor coactivator 5 OS=Salmo salar OX=8030 GN=NCOA5 PE=2 SV=1
4	B5X1C7	1.03e-132	404	676	0.475	0.407	B5X1C7_SALSA Nuclear receptor coactivator 5 OS=Salmo salar OX=8030 GN=NCOA5 PE=2 SV=1
5	U6A492	3.73e-26	114	545	0.173	0.183	NCOA5_SCHMD Nuclear receptor coactivator 5 OS=Schmidtea mediterranea OX=79327 GN=NCOA5 PE=1 SV=1
6	Q9U9Q2	3.34e-25	109	371	0.136	0.213	Q9U9Q2_DROME Neosin, isoform A OS=Drosophila melanogaster OX=7227 GN=Neos PE=2 SV=1
7	Q7KLX0	4.69e-25	109	383	0.136	0.206	Q7KLX0_DROME HL05936p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Neos PE=2 SV=1
8	Q8I3A0	6.90e-09	61.6	2568	0.048	0.011	Q8I3A0_PLAF7 Copper-transporting ATPase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0904900 PE=4 SV=2
9	Q9UTK4	0.006	42.4	1807	0.088	0.028	NU189_SCHPO Nucleoporin nup189 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup189 PE=1 SV=2
10	P38996	0.11	38.1	802	0.029	0.021	NAB3_YEAST Nuclear polyadenylated RNA-binding protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAB3 PE=1 SV=1
11	Q8MVR1	0.13	37.7	2631	0.069	0.015	GBPC_DICDI Cyclic GMP-binding protein C OS=Dictyostelium discoideum OX=44689 GN=gbpC PE=1 SV=1
12	Q586V4	0.17	37.4	835	0.079	0.055	Q586V4_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=28H13.430 PE=4 SV=1
13	P04487	0.40	34.7	161	0.038	0.137	RNB_HHV11 Accessory factor US11 OS=Human herpesvirus 1 (strain 17) OX=10299 GN=US11 PE=1 SV=1
14	A0A0C4DFM7	1.3	34.7	1645	0.029	0.010	A0A0C4DFM7_HUMAN RNA uridylyltransferase OS=Homo sapiens OX=9606 GN=TUT4 PE=1 SV=1
15	O77033	1.3	34.7	1390	0.035	0.014	CYC8_DICDI General transcriptional corepressor trfA OS=Dictyostelium discoideum OX=44689 GN=trfA PE=2 SV=1
16	Q5TAX3	1.3	34.7	1644	0.029	0.010	TUT4_HUMAN Terminal uridylyltransferase 4 OS=Homo sapiens OX=9606 GN=TUT4 PE=1 SV=3
17	P49687	1.5	34.3	1317	0.057	0.025	NU145_YEAST Nucleoporin NUP145 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP145 PE=1 SV=1
18	Q8IHP3	1.6	34.3	2055	0.059	0.017	Q8IHP3_PLAF7 Membrane associated erythrocyte binding-like protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1147800.1 PE=4 SV=1
19	H2L0I2	3.1	33.5	2396	0.060	0.015	H2L0I2_CAEEL Lin-5 (Five) Interacting protein OS=Caenorhabditis elegans OX=6239 GN=lfi-1 PE=1 SV=1
20	Q9SKU1	3.1	33.1	338	0.019	0.033	CLC1_ARATH Clathrin light chain 1 OS=Arabidopsis thaliana OX=3702 GN=At2g20760 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03129 HGTP_anticodon	2.7	19.6	Anticodon binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000290231

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000310668	0.907	Nuclear pore complex protein Nup93
2	9606.ENSP00000264883	0.903	Nucleoporin p54
3	9606.ENSP00000285968	0.882	Nuclear pore complex protein Nup205
4	9606.ENSP00000231498	0.879	Nuclear pore complex protein Nup155
5	9606.ENSP00000373312	0.875	Protein SEC13 homolog
6	9606.ENSP00000352400	0.865	Nuclear pore complex protein Nup214
7	9606.ENSP00000382779	0.864	Nucleoporin SEH1
8	9606.ENSP00000229179	0.847	Nuclear pore complex protein Nup107
9	9606.ENSP00000379182	0.843	mRNA export factor
10	9606.ENSP00000343925	0.834	Estrogen receptor beta
11	9606.ENSP00000361544	0.831	Nucleoporin-62 C-terminal-like protein
12	9606.ENSP00000471191	0.831	Nuclear pore glycoprotein p62
13	9606.ENSP00000290158	0.812	Importin subunit beta-1
14	9606.ENSP00000405330	0.792	Estrogen receptor
15	9606.ENSP00000308622	0.768	Nucleoporin GLE1
16	9606.ENSP00000376615	0.736	5'-nucleotidase domain containing 3
17	9606.ENSP00000316042	0.701	Heterogeneous nuclear ribonucleoprotein A0
18	9606.ENSP00000265753	0.697	Eukaryotic translation initiation factor 4H
19	9606.ENSP00000420608	0.694	ER membrane protein complex subunit 1
20	9606.ENSP00000332706	0.677	Transcriptional activator protein Pur-alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003676	0.998	nucleic acid binding
GO:0003682	0.995	chromatin binding
GO:0005515	0.948	protein binding
GO:0003723	0.884	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.990	cellular process
GO:0048523	0.980	negative regulation of cellular process
GO:1901701	0.973	cellular response to oxygen-containing compound
GO:0009966	0.973	regulation of signal transduction
GO:0023057	0.972	negative regulation of signaling
GO:0010648	0.972	negative regulation of cell communication
GO:0032870	0.971	cellular response to hormone stimulus
GO:1901652	0.959	response to peptide
GO:0007167	0.958	enzyme-linked receptor protein signaling pathway
GO:0042592	0.943	homeostatic process
GO:1900076	0.932	regulation of cellular response to insulin stimulus
GO:0046626	0.932	regulation of insulin receptor signaling pathway
GO:0009968	0.921	negative regulation of signal transduction
GO:0043434	0.895	response to peptide hormone
GO:0032868	0.887	response to insulin
GO:0032869	0.882	cellular response to insulin stimulus
GO:0048878	0.881	chemical homeostasis
GO:0007169	0.876	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0033500	0.865	carbohydrate homeostasis
GO:1900077	0.801	negative regulation of cellular response to insulin stimulus
GO:0008286	0.799	insulin receptor signaling pathway
GO:0046627	0.747	negative regulation of insulin receptor signaling pathway
GO:0042593	0.420	glucose homeostasis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005576	0.997	extracellular region
GO:0005856	0.993	cytoskeleton
GO:0005615	0.986	extracellular space
GO:0015629	0.972	actin cytoskeleton
GO:0032991	0.951	protein-containing complex
GO:0005737	0.774	cytoplasm
GO:0016020	0.526	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]