StarFunc result for job id Q9HCD6

User Input

>input (1990 residues)
MFRNSLKMLLTGGKSSRKNRSSDGGSEEPPDRRQSSVDSRQSRSGQGGISTESDCAFEPD
YAVPPLPVSEGDAEQELGPPPSVDEAANTLMTRLGFLLGEKVTEVQPGDQYSMEVQDENQ
TSAITQRISPCSTLTSSTASPPASSPCSTLPPISTNATAKDCSYGAVTSPTSTLESRDSG
IIATLTSYSENVERTKYAGESSKELGSGGNIKPWQSQKSSMDSCLYRVDENMTASTYSLN
KIPERNLETVLSQSVQSIPLYLMPRPNSVAATSSAHLEDLAYLDEQRHTPLRTSLRMPRQ
SMGGARTQQDLRVRFAPYRPPDISLKPLLFEVPSITTESVFVGRDWVFHEIDAQLQSSNA
SVNQGVVIVGNIGFGKTAIISRLVALSCHGTRMRQIASDSPHASPKHVDANRELPLTQPP
SAHSSITSGSCPGTPEMRRRQEEAMRRLASQVVAYHYCQADNAYTCLVPEFVHNVAALLC
RSPQLTAYREQLLREPHLQSMLSLRSCVQDPMASFRRGVLEPLENLHKERKIPDEDFIIL
IDGLNEAEFHKPDYGDTIVSFLSKMIGKFPSWLKLIVTVRTSLQEITKLLPFHRIFLDRL
EENEAIDQDLQAYILHRIHSSSEIQNNISLNGKMDNTTFGKLSSHLKTLSQGSYLYLKLT
FDLIEKGYLVLKSSSYKVVPVSLSEVYLLQCNMKFPTQSSFDRVMPLLNVAVASLHPLTD
EHIFQAINAGSIEGTLEWEDFQQRMENLSMFLIKRRDMTRMFVHPSFREWLIWREEGEKT
KFLCDPRSGHTLLAFWFSRQEGKLNRQQTIELGHHILKAHIFKGLSKKVGVSSSILQGLW
ISYSTEGLSMALASLRNLYTPNIKVSRLLILGGANINYRTEVLNNAPILCVQSHLGYTEM
VALLLEFGANVDASSESGLTPLGYAAAAGYLSIVVLLCKKRAKVDHLDKNGQCALVHAAL
RGHLEVVKFLIQCDWTMAGQQQGVFKKSHAIQQALIAAASMGYTEIVSYLLDLPEKDEEE
VERAQINSFDSLWGETALTAAAGRGKLEVCRLLLEQGAAVAQPNRRGAVPLFSTVRQGHW
QIVDLLLTHGADVNMADKQGRTPLMMAASEGHLGTVDFLLAQGASIALMDKEGLTALSWA
CLKGHLSVVRSLVDNGAATDHADKNGRTPLDLAAFYGDAEVVQFLVDHGAMIEHVDYSGM
RPLDRAVGCRNTSVVVTLLKKGAKIGPATWAMATSKPDIMIILLSKLMEEGDMFYKKGKV
KEAAQRYQYALKKFPREGFGEDLKTFRELKVSLLLNLSRCRRKMNDFGMAEEFATKALEL
KPKSYEAYYARARAKRSSRQFAAALEDLNEAIKLCPNNREIQRLLLRVEEECRQMQQPQQ
PPPPPQPQQQLPEEAEPEPQHEDIYSVQDIFEEEYLEQDVENVSIGLQTEARPSQGLPVI
QSPPSSPPHRDSAYISSSPLGSHQVFDFRSSSSVGSPTRQTYQSTSPALSPTHQNSHYRP
SPPHTSPAHQGGSYRFSPPPVGGQGKEYPSPPPSPLRRGPQYRASPPAESMSVYRSQSGS
PVRYQQETSVSQLPGRPKSPLSKMAQRPYQMPQLPVAVPQQGLRLQPAKAQIVRSNQPSP
AVHSSTVIPTGAYGQVAHSMASKYQSSQGDIGVSQSRLVYQGSIGGIVGDGRPVQHVQAS
LSAGAICQHGGLTKEDLPQRPSSAYRGGVRYSQTPQIGRSQSASYYPVCHSKLDLERSSS
QLGSPDVSHLIRRPISVNPNEIKPHPPTPRPLLHSQSVGLRFSPSSNSISSTSNLTPTFR
PSSSIQQMEIPLKPAYERSCDELSPVSPTQGGYPSEPTRSRTTPFMGIIDKTARTQQYPH
LHQQNRTWAVSSVDTVLSPTSPGNLPQPESFSPPSSISNIAFYNKTNNAQNGHLLEDDYY
SPHGMLANGSRGDLLERVSQASSYPDVKVARTLPVAQAYQDNLYRQLSRDSRQGQTSPIK
PKRPFVESNV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2A690	0.597	0.596	0.000	1994	0.982	0.980	A2A690.pdb.gz	TANC2_MOUSE Protein TANC2 OS=Mus musculus OX=10090 GN=Tanc2 PE=1 SV=1
2	AFDB:Q0VGY8	0.537	0.574	0.000	1856	0.490	0.525	Q0VGY8.pdb.gz	TANC1_MOUSE Protein TANC1 OS=Mus musculus OX=10090 GN=Tanc1 PE=1 SV=2
3	AFDB:Q9C0D5	0.526	0.560	0.000	1861	0.503	0.537	Q9C0D5.pdb.gz	TANC1_HUMAN Protein TANC1 OS=Homo sapiens OX=9606 GN=TANC1 PE=1 SV=3
4	PDB:8cs9A	0.193	0.442	3.123E-17	796	0.075	0.187	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
5	AFDB:E9QEX9	0.173	0.137	5.322E-17	2607	0.169	0.129	E9QEX9.pdb.gz	E9QEX9_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=1
6	PDB:5vkqA	0.164	0.204	1.320E-13	1499	0.072	0.095	5vkqA.pdb.gz
7	PDB:4oauC	0.120	0.303	1.929E-10	692	0.049	0.142	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
8	AFDB:Q8WXD9	0.118	0.162	7.672E-9	1431	0.106	0.147	Q8WXD9.pdb.gz	CSKI1_HUMAN Caskin-1 OS=Homo sapiens OX=9606 GN=CASKIN1 PE=1 SV=1
9	AFDB:A0A3B3ISP1	0.113	0.185	8.597E-9	1194	0.077	0.128	A0A3B3ISP1.pdb.gz	A0A3B3ISP1_HUMAN Ankyrin repeat and sterile alpha motif domain containing 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=1
10	PDB:2dvwA	0.090	0.720	1.078E-8	229	0.031	0.271	2dvwA.pdb.gz
11	PDB:1wg0A	0.102	0.755	4.558E-8	243	0.032	0.263	1wg0A.pdb.gz
12	AFDB:Q8N2N9	0.095	0.138	6.674E-8	1353	0.075	0.111	Q8N2N9.pdb.gz	AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens OX=9606 GN=ANKRD36B PE=1 SV=4
13	PDB:6v9hC	0.098	0.585	2.713E-7	270	0.030	0.219	6v9hC.pdb.gz
14	PDB:6mwqA	0.073	0.288	4.443E-7	493	0.029	0.118	6mwqA.pdb.gz
15	PDB:6jd6B	0.083	0.788	7.278E-7	192	0.023	0.240	6jd6B.pdb.gz
16	AFDB:G3X8Q1	0.068	0.064	2.110E-6	2187	0.114	0.103	G3X8Q1.pdb.gz	G3X8Q1_MOUSE Calcineurin binding protein 1 OS=Mus musculus OX=10090 GN=Cabin1 PE=1 SV=1
17	PDB:6aunA	0.094	0.259	2.188E-6	618	0.038	0.121	6aunA.pdb.gz
18	AFDB:G5EG29	0.059	0.118	5.449E-6	968	0.077	0.159	G5EG29.pdb.gz	G5EG29_CAEEL cGMP-dependent protein kinase interacting domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mel-11 PE=1 SV=1
19	AFDB:Q6PR54	0.063	0.056	7.383E-6	2419	0.089	0.074	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
20	PDB:8a3tJ	0.069	0.236	1.077E-5	509	0.038	0.147	8a3tJ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2A690	0.0	4034	1994	0.983	0.981	TANC2_MOUSE Protein TANC2 OS=Mus musculus OX=10090 GN=Tanc2 PE=1 SV=1
2	F1LTE0	0.0	4026	1992	0.980	0.979	TANC2_RAT Protein TANC2 OS=Rattus norvegicus OX=10116 GN=Tanc2 PE=1 SV=2
3	M9PC91	0.0	895	1798	0.241	0.266	M9PC91_DROME Rolling pebbles, isoform I OS=Drosophila melanogaster OX=7227 GN=rols PE=4 SV=1
4	M9PF75	0.0	895	1799	0.241	0.266	M9PF75_DROME Rolling pebbles, isoform G OS=Drosophila melanogaster OX=7227 GN=rols PE=4 SV=1
5	M9PFC6	0.0	893	1669	0.241	0.287	M9PFC6_DROME Rolling pebbles, isoform F OS=Drosophila melanogaster OX=7227 GN=rols PE=4 SV=1
6	M9PI28	0.0	892	1568	0.241	0.305	M9PI28_DROME Rolling pebbles, isoform H OS=Drosophila melanogaster OX=7227 GN=rols PE=4 SV=1
7	Q0VGY8	0.0	1710	1856	0.439	0.470	TANC1_MOUSE Protein TANC1 OS=Mus musculus OX=10090 GN=Tanc1 PE=1 SV=2
8	Q6F6B3	0.0	1697	1849	0.435	0.468	TANC1_RAT Protein TANC1 OS=Rattus norvegicus OX=10116 GN=Tanc1 PE=1 SV=1
9	Q8WS23	0.0	894	1670	0.241	0.287	Q8WS23_DROME Rolling pebbles isoform 6 OS=Drosophila melanogaster OX=7227 GN=rols PE=2 SV=1
10	Q8WS24	0.0	895	1900	0.241	0.252	Q8WS24_DROME Rolling pebbles isoform 7 OS=Drosophila melanogaster OX=7227 GN=rols PE=2 SV=1
11	Q8WTD1	0.0	892	1569	0.241	0.305	Q8WTD1_DROME Rolling pebbles isoform 6 OS=Drosophila melanogaster OX=7227 GN=rols PE=2 SV=1
12	Q8WTD2	0.0	896	1900	0.241	0.252	Q8WTD2_DROME Rolling pebbles isoform 7 OS=Drosophila melanogaster OX=7227 GN=rols PE=2 SV=1
13	Q9C0D5	0.0	1744	1861	0.435	0.465	TANC1_HUMAN Protein TANC1 OS=Homo sapiens OX=9606 GN=TANC1 PE=1 SV=3
14	Q9HCD6	0.0	4109	1990	1.000	1.000	TANC2_HUMAN Protein TANC2 OS=Homo sapiens OX=9606 GN=TANC2 PE=1 SV=3
15	Q9VTS6	0.0	894	1670	0.241	0.287	Q9VTS6_DROME Antisocial isoform 2 OS=Drosophila melanogaster OX=7227 GN=rols PE=2 SV=2
16	Q9VTS8	0.0	892	1569	0.241	0.305	Q9VTS8_DROME Antisocial isoform 1 OS=Drosophila melanogaster OX=7227 GN=rols PE=2 SV=2
17	Q9VTS9	0.0	896	1900	0.241	0.252	Q9VTS9_DROME Rolling pebbles, isoform B OS=Drosophila melanogaster OX=7227 GN=rols PE=4 SV=2
18	Q9ULJ7	7.44e-96	344	1429	0.142	0.197	ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4
19	O75179	2.74e-45	183	2603	0.068	0.052	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
20	H0YM23	2.96e-45	183	2487	0.068	0.055	H0YM23_HUMAN Ankyrin repeat domain 17 (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	4.2	19.2	AAA ATPase domain
2	PF12895 ANAPC3	9.4e+02	11.5	Anaphase-promoting complex, cyclosome, subunit 3
3	PF00023 Ank	2.3e-25	99.1	Ankyrin repeat
4	PF12796 Ank_2	7.2e-73	252.5	Ankyrin repeats (3 copies)
5	PF13606 Ank_3	6.1e-29	107.7	Ankyrin repeat
6	PF13637 Ank_4	3.3e-40	147.2	Ankyrin repeats (many copies)
7	PF13857 Ank_5	1e-30	116.7	Ankyrin repeats (many copies)
8	PF19557 DUF6079	1.1e+02	11.6	Family of unknown function (DUF6079)
9	PF00515 TPR_1	0.0029	28.6	Tetratricopeptide repeat
10	PF13414 TPR_11	0.00012	33.0	TPR repeat
11	PF13424 TPR_12	6	18.6	Tetratricopeptide repeat
12	PF13428 TPR_14	0.36	22.8	Tetratricopeptide repeat
13	PF13432 TPR_16	1.2	21.1	Tetratricopeptide repeat
14	PF13431 TPR_17	5.7e+02	12.3	Tetratricopeptide repeat
15	PF14559 TPR_19	12	17.7	Tetratricopeptide repeat
16	PF07719 TPR_2	7.8e-07	39.8	Tetratricopeptide repeat
17	PF13181 TPR_8	0.0011	30.0	Tetratricopeptide repeat
18	PF13371 TPR_9	0.14	23.6	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000387593

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382428	0.747	Disks large homolog 4
2	9606.ENSP00000483236	0.689	DDB1- and CUL4-associated factor 7
3	9606.ENSP00000427130	0.627	Ankyrin repeat domain-containing protein 13D
4	9606.ENSP00000254260	0.619	Rhophilin-2
5	9606.ENSP00000341779	0.596	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
6	9606.ENSP00000435466	0.570	Kin of IRRE-like protein 3
7	9606.ENSP00000352138	0.561	Kin of IRRE-like protein 1
8	9606.ENSP00000260526	0.553	Rho GTPase-activating protein 29
9	9606.ENSP00000359160	0.551	tRNA:m(4)X modification enzyme TRM13 homolog
10	9606.ENSP00000326031	0.513	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
11	9606.ENSP00000303887	0.501	Serine/threonine-protein kinase DCLK2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050789	0.961	regulation of biological process
GO:0032501	0.930	multicellular organismal process
GO:0050794	0.910	regulation of cellular process
GO:0048856	0.881	anatomical structure development
GO:0007275	0.810	multicellular organism development
GO:0051179	0.405	localization
GO:0048518	0.398	positive regulation of biological process
GO:0009790	0.391	embryo development
GO:0009792	0.380	embryo development ending in birth or egg hatching
GO:0001701	0.362	in utero embryonic development
GO:0048522	0.357	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	0.998	cell junction
GO:0043229	0.998	intracellular organelle
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0045202	0.986	synapse
GO:0030425	0.970	dendrite
GO:0005829	0.962	cytosol
GO:0016020	0.874	membrane
GO:0043227	0.815	membrane-bounded organelle
GO:0098794	0.801	postsynapse
GO:0043231	0.790	intracellular membrane-bounded organelle
GO:0044309	0.789	neuron spine
GO:0043197	0.738	dendritic spine
GO:0098984	0.427	neuron to neuron synapse
GO:0099572	0.371	postsynaptic specialization
GO:0098793	0.369	presynapse
GO:0098978	0.358	glutamatergic synapse
GO:0071944	0.336	cell periphery
GO:0043679	0.331	axon terminus
GO:0099091	0.308	postsynaptic specialization, intracellular component

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]