StarFunc result for job id Q9HCE0

User Input

>input (2579 residues)
MAEAVKPQRRAKAKASRTKTKEKKKYETPQREESSEVSLPKTSREQEIPSLACEFKGDHL
KVVTDSQLQDDASGQNESEMFDVPLTSLTISNEESLTCNTEPPKEGGEARPCVGDSAVTP
KVHPGDNVGTKVETPKNFTEVEENMSVQGGLSESAPQSNFSYTQPAMENIQVRETQNSKE
DKQGLVCSSEVPQNVGLQSSCPAKHGFQTPRVKKLYPQLPAEIAGEAPALVAVKPLLRSE
RLYPELPSQLELVPFTKEQLKILEPGSWLENVESYLEEFDSMAHQDRHEFYELLLNYSRC
RKQLLLAEAELLTLTSDCQNAKSRLWQFKEEQMSVQGICADQVKVFSYHRYQRVEMNENA
LVELKKLFDAKSEHLHQTLALHSYTSVLSRLQVESYIYALLSSSAVLRSSAIHQQGRASK
QTESIPSDLCQLKECISVLFMFTRRVNEDTQFHDDILLWLQKLVSVLQRVGCPGDHLFLL
NHILRCPAGVSKWAVPFIQIKVLHNPSGVFHFMQSLALLMSPVKNRAEFMCHMKPSERKP
SSSGPGSGTWTLVDEGGEEDEDPETSWILLNEDDLVTILAQFPFHELFQHLLGFKAKGDY
LPETTRPQEMMKIFAFANSLVELLAVGLETFNRARYRQFVKRIGYMIRMTLGYVSDHWAQ
YVSHNQGSGLAQQPYSMEKLQVEFDELFLRAVLHVLKAKRLGIWLFMSEMPFGTLSVQML
WKLFYLMHQVESENLQQLSSSLQPAQCKQQLQDPEHFTNFEKCLSSMNSSEEICLLTTFA
QMAQARRTNVDEDFIKIIVLEIYEVSYVTLSTRETFSKVGRELLGTITAVHPEIISVLLD
RVQETIDQVGMVSLYLFKELPLYLWQPSASEIAVIRDWLLNYNLTVVKNKLACVILEGLN
WGFAKQATLHLDQAVHAEVALMVLEAYQKYLAQKPYAGILSESMKQVSYLASIVRYGETP
ETSFNQWAWNLILRLKLHKNDYGIQPNCPAVPFSVTVPDMTESPTFHPLLKAVKAGMPIG
CYLALSMTAVGHSIEKFCAEGIPLLGILVQSRHLRTVVHVLDKILPLFYPCQYYLLKNEQ
FLSHLLLFLHLDSGVPQGVTQQVTHKVAQHLTGASHGDNVKLLNSMIQAHISVSTQPNEV
GPVAVLEFWVQALISQHLWYREQPILFLMDHLCKAAFQLMQEDCIQKLLYQQHKNALGYH
CDRSLLSSLVSWIVAGNITPSFVEGLATPTQVWFAWTVLNMESIFEEDSQLRRVIEGELV
INSAFTPDQALKKAQTQLKLPIVPSLQRLLIYRWAHQALVTPSDHPLLPLIWQKFFLLYL
HRPGPQYGLPIDGCIGRRFFQSPAHINLLKEMKRRLTEVADFHHAASKALRVPAEGSEGL
PESHSGTPGYLTSPELHKELVRLFNVYILWLEDENFQKGDTYIPSLPKHYDIHRLAKVMQ
NQQDLWMEYLNMERIYHEFQETVGLWTQAKLESHSTPCSLSVQLDFTDPLLAKERVLSNL
RKHEAPQPPLALHPTKPPVPVISSAVLLSQKDATQLVCTDLNLLQQQARTAALRESQQVA
LDGELLDTMPKQYVNREEQTTLHLECRGSSGKKCQGAAVVTVQFEGMHKNEAISQQLHVL
RKEVKQLQAEAAKPPSLNIVEAAVHAENLITALVNAYKLQPTPGIQKVGISLFFTIVDYV
SDETQRHPPTRQFFTSCIEILGQVFISGIKSECRKVLETILKNSRLCSLLSPFFTPNAAP
AEFIQLYEQVVKFLSEDNSDMIFMLLTKFDLKQWLSATKPPLSDRTRLLESIHLALTAWG
LEPDEDILMPFNLFCKHWTYLLLYQFPDQYSDILRLLMQSSAEQLLSPECWKATLRALGC
CAPSCQQGAASTEGAVLPSSSDALLSDKQVMETIQWLSDFFYKLRLSKMDFKSFGLFSKW
SPYMADVKTFLGYLVKRLIDLEMTCLAQDPTASRKTVLKSLHSVIIQLFKPWILVLEDNE
SSQQRHYPWLESDTVVASSIVQLFTDCIDSLHESFKDKLLPGDAGALWLHLMHYCEACTA
PKMPEFILYAFHSTYRKLPWKDLHPDQMLMEAFFKVERGSPKSCFLFLGSVLCEVNWVSV
LSDAWNSSPHPETRSMIVCLLFMMILLAKEVQLVDQTDSPLLSLLGQTSSLSWHLVDIVS
YQSVLSYFSSHYPPSIILAKESYAELIMKLLKVSAGLSIPTDSQKHLDAVPKCQAFTHQM
VQFLSTLEQNGKITLAVLEQEMSKLLDDIIVFNPPDMDSQTRHMALSSLFMEVLMMMNNA
TIPTAEFLRGSIRTWIGQKMHGLVVLPLLTAACQSLASVRHMAETTEACITAYFKESPLN
QNSGWGPILVSLQVPELTMEEFLQECLTLGSYLTLYVYLLQCLNSEQTLRNEMKVLLILS
KWLEQVYPSSVEEEAKLFLWWHQVLQLSLIQTEQNDSVLTESVIRILLLVQSRQNLVAEE
RLSSGILGAIGFGRKSPLSNRFRVVARSMAAFLSVQVPMEDQIRLRPGSELHLTPKAQQA
LNALESMASSKQYVEYQDQILQATQFIRHPGHCLQDGKSFLALLVNCLYPEVHYLDHIR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HCE0	1.000	1.000	0.000	2579	1.000	1.000	Q9HCE0.pdb.gz	EPG5_HUMAN Ectopic P granules protein 5 homolog OS=Homo sapiens OX=9606 GN=EPG5 PE=1 SV=2
2	PDB:7tyrA	0.095	0.072	6.568E-8	3905	0.117	0.078	7tyrA.pdb.gz
3	PDB:7mq8LM	0.103	0.119	8.857E-8	2005	0.108	0.139	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
4	PDB:7r04B	0.099	0.108	1.068E-7	2229	0.098	0.114	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
5	PDB:7mqaLM	0.099	0.114	1.287E-7	2041	0.096	0.122	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
6	PDB:7otmA	0.104	0.085	1.735E-7	3656	0.109	0.077	7otmA.pdb.gz	Structural insights into inhibitor regulation of the DNA repair protein DNA-PKcs.
7	PDB:7jq9A	0.110	0.115	2.092E-7	2427	0.095	0.101	7jq9A.pdb.gz
8	PDB:7sglA	0.090	0.071	4.099E-7	3852	0.124	0.083	7sglA.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
9	PDB:8escZ	0.090	0.073	5.957E-7	3543	0.123	0.089	8escZ.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.
10	PDB:7mopA	0.095	0.098	6.419E-7	2445	0.093	0.098	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
11	PDB:7ua3A	0.099	0.068	6.419E-7	4443	0.112	0.065	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
12	AFDB:R4GLV5	0.060	0.092	1.311E-4	1116	0.069	0.159	R4GLV5.pdb.gz
13	AFDB:A0A024R1Q0	0.066	0.108	3.596E-4	1141	0.060	0.137	A0A024R1Q0.pdb.gz
14	AFDB:Q1MTM9	0.047	0.088	1.252E-2	977	0.040	0.105	Q1MTM9.pdb.gz	YFN1_SCHPO Uncharacterized transcriptional regulatory protein C1327.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1327.01c PE=1 SV=2
15	AFDB:O59780	0.044	0.095	1.626E-2	867	0.041	0.123	O59780.pdb.gz	YCN3_SCHPO Uncharacterized transcriptional regulatory protein C320.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC320.03 PE=3 SV=1
16	AFDB:Q9UQB3	0.057	0.093	1.688E-2	1225	0.043	0.091	Q9UQB3.pdb.gz	CTND2_HUMAN Catenin delta-2 OS=Homo sapiens OX=9606 GN=CTNND2 PE=1 SV=3
17	AFDB:Q8INC3	0.051	0.056	2.113E-2	2194	0.105	0.123	Q8INC3.pdb.gz	Q8INC3_DROME Myosin heavy chain-like, isoform B OS=Drosophila melanogaster OX=7227 GN=Mhcl PE=3 SV=2
18	AFDB:P39960	0.049	0.053	2.277E-2	2167	0.079	0.094	P39960.pdb.gz	BEM2_YEAST GTPase-activating protein BEM2/IPL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BEM2 PE=1 SV=1
19	AFDB:Q9P789	0.050	0.079	2.277E-2	1065	0.039	0.095	Q9P789.pdb.gz	YN8E_SCHPO Pumilio domain-containing protein P35G2.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP35G2.14 PE=1 SV=2
20	AFDB:O75122	0.054	0.095	2.547E-2	1294	0.050	0.100	O75122.pdb.gz	CLAP2_HUMAN CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A5WUT8	0.0	2900	2532	0.558	0.569	EPG5_DANRE Ectopic P granules protein 5 homolog OS=Danio rerio OX=7955 GN=epg5 PE=3 SV=1
2	Q80TA9	0.0	4406	2572	0.836	0.838	EPG5_MOUSE Ectopic P granules protein 5 homolog OS=Mus musculus OX=10090 GN=Epg5 PE=1 SV=2
3	Q9HCE0	0.0	5324	2579	1.000	1.000	EPG5_HUMAN Ectopic P granules protein 5 homolog OS=Homo sapiens OX=9606 GN=EPG5 PE=1 SV=2
4	Q9VE34	9.69e-154	536	2455	0.226	0.237	EPG5_DROME Ectopic P granules protein 5 homolog OS=Drosophila melanogaster OX=7227 GN=Epg5 PE=1 SV=2
5	Q18892	4.95e-56	219	1599	0.131	0.211	EPG5_CAEEL Ectopic P granules protein 5 OS=Caenorhabditis elegans OX=6239 GN=epg-5 PE=2 SV=1
6	P39106	1.2	37.0	762	0.007	0.022	MNN1_YEAST Alpha-1,3-mannosyltransferase MNN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN1 PE=1 SV=1
7	Q54G37	2.3	35.8	475	0.007	0.036	Q54G37_DICDI Ubiquitin carboxyl-terminal hydrolase OS=Dictyostelium discoideum OX=44689 GN=usp12 PE=3 SV=2
8	Q96V54	2.5	35.8	766	0.008	0.026	CREB_EMENI Ubiquitin carboxyl-terminal hydrolase creB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=creB PE=1 SV=1
9	Q8SWV4	6.4	34.7	1158	0.010	0.023	Q8SWV4_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Alk PE=2 SV=1
10	Q7KJ08	6.9	34.7	1701	0.010	0.016	Q7KJ08_DROME receptor protein-tyrosine kinase OS=Drosophila melanogaster OX=7227 GN=Alk PE=2 SV=1
11	Q9P2L0	6.9	34.7	1181	0.013	0.028	WDR35_HUMAN WD repeat-containing protein 35 OS=Homo sapiens OX=9606 GN=WDR35 PE=1 SV=3
12	Q387L7	8.0	34.3	713	0.013	0.046	Q387L7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0800 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19554 DUF6077	26	15.1	Family of unknown function (DUF6077)
2	PF08970 Sda	2.8e+02	12.7	Sporulation inhibitor A

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282041

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265062	0.844	Ras-related protein Rab-7a
2	9606.ENSP00000278903	0.840	Etoposide-induced protein 2.4 homolog
3	9606.ENSP00000215730	0.827	Synaptosomal-associated protein 29
4	9606.ENSP00000262291	0.798	Vacuole membrane protein 1
5	9606.ENSP00000259400	0.778	Syntaxin-17
6	9606.ENSP00000358072	0.778	Autophagy protein 5
7	9606.ENSP00000247178	0.768	Beclin 1-associated autophagy-related key regulator
8	9606.ENSP00000346437	0.757	Ubiquitin-like modifier-activating enzyme ATG7
9	9606.ENSP00000355511	0.752	Rab proteins geranylgeranyltransferase component A 2
10	9606.ENSP00000263864	0.744	Vesicle-associated membrane protein 8
11	9606.ENSP00000350386	0.732	Rab proteins geranylgeranyltransferase component A 1
12	9606.ENSP00000348848	0.707	WD repeat domain phosphoinositide-interacting protein 4
13	9606.ENSP00000338990	0.704	Autophagy-related protein 101
14	9606.ENSP00000365536	0.700	PRA1 family protein
15	9606.ENSP00000405726	0.698	Cell division control protein 45 homolog
16	9606.ENSP00000283290	0.693	Ubiquitin-like-conjugating enzyme ATG3
17	9606.ENSP00000479762	0.688	Ras-related protein Rab-7b
18	9606.ENSP00000420321	0.677	Roundabout homolog 1
19	9606.ENSP00000352510	0.672	Tectonin beta-propeller repeat-containing protein 2
20	9606.ENSP00000432412	0.671	Autophagy-related protein 13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0006810	0.969	transport
GO:0051641	0.965	cellular localization
GO:0051649	0.962	establishment of localization in cell
GO:0016192	0.960	vesicle-mediated transport
GO:0046907	0.952	intracellular transport
GO:0050789	0.951	regulation of biological process
GO:0050794	0.943	regulation of cellular process
GO:0008152	0.942	metabolic process
GO:0044237	0.924	cellular metabolic process
GO:0071840	0.909	cellular component organization or biogenesis
GO:0016043	0.903	cellular component organization
GO:0006914	0.890	autophagy
GO:0048518	0.885	positive regulation of biological process
GO:0050896	0.861	response to stimulus
GO:0016236	0.800	macroautophagy
GO:0051716	0.784	cellular response to stimulus
GO:0007154	0.534	cell communication
GO:0023052	0.500	signaling
GO:0048583	0.474	regulation of response to stimulus
GO:0006996	0.455	organelle organization
GO:0007041	0.363	lysosomal transport
GO:0032101	0.351	regulation of response to external stimulus
GO:0048584	0.335	positive regulation of response to stimulus
GO:0007165	0.330	signal transduction
GO:0022411	0.327	cellular component disassembly
GO:0008333	0.318	endosome to lysosome transport
GO:0002753	0.300	cytosolic pattern recognition receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048471	0.998	perinuclear region of cytoplasm
GO:0005764	0.998	lysosome
GO:0005829	0.938	cytosol
GO:0016020	0.909	membrane
GO:0031090	0.897	organelle membrane
GO:0012505	0.856	endomembrane system
GO:0098588	0.854	bounding membrane of organelle
GO:0031982	0.784	vesicle
GO:0005634	0.600	nucleus
GO:0031974	0.549	membrane-enclosed lumen
GO:0070013	0.543	intracellular organelle lumen
GO:0031981	0.517	nuclear lumen
GO:0005654	0.385	nucleoplasm
GO:0005774	0.368	vacuolar membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]