StarFunc result for job id Q9HCE5

User Input

>input (456 residues)
MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAP
NAKRKYLDEGETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYC
QHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIR
ELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEG
LDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRST
DGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTV
GPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGG
TSAGRGRERNRSNFRGERGGFRGGRGGAHRGGFPPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3UIK4	0.765	0.765	7.950E-88	456	0.987	0.987	Q3UIK4.pdb.gz	MET14_MOUSE N6-adenosine-methyltransferase non-catalytic subunit OS=Mus musculus OX=10090 GN=Mettl14 PE=1 SV=1
2	AFDB:Q9VLP7	0.652	0.747	5.203E-58	397	0.566	0.650	Q9VLP7.pdb.gz	MET14_DROME N6-adenosine-methyltransferase non-catalytic subunit OS=Drosophila melanogaster OX=7227 GN=Mettl14 PE=1 SV=1
3	PDB:6y4gB	0.519	0.951	5.273E-45	246	0.529	0.980	6y4gB.pdb.gz	Small-Molecule Inhibitors of METTL3, the Major Human Epitranscriptomic Writer.
4	AFDB:Q94AI4	0.444	0.264	1.489E-27	775	0.279	0.164	Q94AI4.pdb.gz	METL1_ARATH N6-adenosine-methyltransferase non-catalytic subunit MTB OS=Arabidopsis thaliana OX=3702 GN=MTB PE=1 SV=1
5	AFDB:P25583	0.538	0.720	2.765E-25	335	0.204	0.278	P25583.pdb.gz	MET14_YEAST Karyogamy protein KAR4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KAR4 PE=1 SV=1
6	AFDB:Q86U44	0.384	0.305	1.297E-20	580	0.143	0.112	Q86U44.pdb.gz	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit OS=Homo sapiens OX=9606 GN=METTL3 PE=1 SV=2
7	AFDB:F1R777	0.385	0.305	3.467E-20	584	0.140	0.110	F1R777.pdb.gz	MTA70_DANRE N6-adenosine-methyltransferase subunit METTL3 OS=Danio rerio OX=7955 GN=mettl3 PE=2 SV=1
8	AFDB:O82486	0.396	0.270	6.411E-20	685	0.162	0.108	O82486.pdb.gz	MTA70_ARATH N6-adenosine-methyltransferase MT-A70-like OS=Arabidopsis thaliana OX=3702 GN=MTA PE=1 SV=2
9	PDB:5teyA	0.385	0.820	9.407E-20	205	0.143	0.317	5teyA.pdb.gz	Human METTL3-METTL14 complex
10	AFDB:Q9VCE6	0.383	0.292	1.115E-19	608	0.191	0.143	Q9VCE6.pdb.gz	MTA70_DROME N6-adenosine-methyltransferase MT-A70-like protein OS=Drosophila melanogaster OX=7227 GN=Mettl3 PE=1 SV=1
11	AFDB:Q3U034	0.308	0.300	4.011E-10	471	0.112	0.108	Q3U034.pdb.gz	METL4_MOUSE N(6)-adenine-specific methyltransferase METTL4 OS=Mus musculus OX=10090 GN=Mettl4 PE=1 SV=1
12	AFDB:Q8N3J2	0.330	0.320	7.886E-10	472	0.083	0.081	Q8N3J2.pdb.gz	METL4_HUMAN N(6)-adenine-specific methyltransferase METTL4 OS=Homo sapiens OX=9606 GN=METTL4 PE=1 SV=3
13	PDB:1booA	0.306	0.462	8.586E-6	282	0.059	0.096	1booA.pdb.gz	Structure of pvu II DNA-(cytosine N4) methyltransferase, an example of domain permutation and protein fold assignment.
14	PDB:5ergB	0.125	0.172	1.371E-2	324	0.048	0.068	5ergB.pdb.gz	Crystal structure of the two-subunit tRNA m(1)A58 methyltransferase TRM6-TRM61 from Saccharomyces cerevisiae.
15	PDB:2an3B	0.132	0.195	2.534E-2	269	0.059	0.100	2an3B.pdb.gz	Mode of binding of methyl acceptor substrates to the adrenaline-synthesizing enzyme phenylethanolamine N-methyltransferase: implications for catalysis
16	PDB:3cjtA	0.114	0.184	3.446E-2	254	0.046	0.083	3cjtA.pdb.gz	Multiple-Site Trimethylation of Ribosomal Protein L11 by the PrmA Methyltransferase.
17	PDB:6yxxE4	0.170	0.177	4.407E-2	434	0.026	0.028	6yxxE4.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
18	PDB:3a27A	0.119	0.198	5.299E-2	219	0.048	0.100	3a27A.pdb.gz	Structural basis of AdoMet-dependent aminocarboxypropyl transfer reaction catalyzed by tRNA-wybutosine synthesizing enzyme, TYW2
19	PDB:7wttq	0.160	0.283	5.992E-2	235	0.050	0.098	7wttq.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
20	PDB:2y7hB	0.154	0.135	6.372E-2	529	0.055	0.047	2y7hB.pdb.gz	The Structure of M.Ecoki Type I DNA Methyltransferase with a DNA Mimic Antirestriction Protein.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UIK4	0.0	929	456	0.987	0.987	MET14_MOUSE N6-adenosine-methyltransferase non-catalytic subunit OS=Mus musculus OX=10090 GN=Mettl14 PE=1 SV=1
2	Q9HCE5	0.0	942	456	1.000	1.000	MET14_HUMAN N6-adenosine-methyltransferase non-catalytic subunit OS=Homo sapiens OX=9606 GN=METTL14 PE=1 SV=2
3	Q9VLP7	1.17e-173	494	397	0.557	0.640	MET14_DROME N6-adenosine-methyltransferase non-catalytic subunit OS=Drosophila melanogaster OX=7227 GN=Mettl14 PE=1 SV=1
4	Q94AI4	3.69e-78	260	775	0.270	0.159	METL1_ARATH N6-adenosine-methyltransferase non-catalytic subunit MTB OS=Arabidopsis thaliana OX=3702 GN=MTB PE=1 SV=1
5	P25583	3.44e-28	116	335	0.184	0.251	MET14_YEAST Karyogamy protein KAR4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KAR4 PE=1 SV=1
6	Q86U44	5.93e-23	103	580	0.145	0.114	MTA70_HUMAN N6-adenosine-methyltransferase catalytic subunit OS=Homo sapiens OX=9606 GN=METTL3 PE=1 SV=2
7	Q8C3P7	7.74e-23	103	580	0.143	0.112	MTA70_MOUSE N6-adenosine-methyltransferase subunit METTL3 OS=Mus musculus OX=10090 GN=Mettl3 PE=1 SV=2
8	F1R777	4.32e-22	101	584	0.145	0.113	MTA70_DANRE N6-adenosine-methyltransferase subunit METTL3 OS=Danio rerio OX=7955 GN=mettl3 PE=2 SV=1
9	Q9VCE6	7.71e-22	100	608	0.151	0.113	MTA70_DROME N6-adenosine-methyltransferase MT-A70-like protein OS=Drosophila melanogaster OX=7227 GN=Mettl3 PE=1 SV=1
10	O82486	2.81e-21	99.0	685	0.162	0.108	MTA70_ARATH N6-adenosine-methyltransferase MT-A70-like OS=Arabidopsis thaliana OX=3702 GN=MTA PE=1 SV=2
11	P41833	2.10e-20	96.3	600	0.164	0.125	MTA70_YEAST N6-adenosine-methyltransferase IME4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IME4 PE=1 SV=1
12	Q9VER8	0.003	42.4	359	0.086	0.109	Q9VER8_DROME LD37858p OS=Drosophila melanogaster OX=7227 GN=Mettl4 PE=2 SV=1
13	Q9SB00	0.038	38.9	496	0.110	0.101	PHR_ARATH Deoxyribodipyrimidine photo-lyase OS=Arabidopsis thaliana OX=3702 GN=PHR1 PE=2 SV=1
14	P35207	0.65	35.0	1287	0.068	0.024	SKI2_YEAST Antiviral helicase SKI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKI2 PE=1 SV=2
15	Q8CJ44	0.75	34.7	572	0.066	0.052	S13A5_RAT Na(+)/citrate cotransporter OS=Rattus norvegicus OX=10116 GN=Slc13a5 PE=1 SV=1
16	Q92766	5.1	32.3	1687	0.059	0.016	RREB1_HUMAN Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1 PE=1 SV=3
17	Q9BQS8	6.0	32.0	1478	0.086	0.026	FYCO1_HUMAN FYVE and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FYCO1 PE=1 SV=3
18	Q80YT5	8.9	31.2	790	0.046	0.027	SPT20_MOUSE Spermatogenesis-associated protein 20 OS=Mus musculus OX=10090 GN=Spata20 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05063 MT-A70	5e-60	213.8	MT-A70

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000010848

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000013487	0.999	Wilms tumor 1 associated protein
2	61853.ENSNLEP00000017753	0.996	Methyltransferase like 3
3	61853.ENSNLEP00000003915	0.971	Vir like m6A methyltransferase associated
4	61853.ENSNLEP00000003081	0.970	Zinc finger CCCH-type containing 13
5	61853.ENSNLEP00000004348	0.967	RNA binding motif protein 15
6	61853.ENSNLEP00000022433	0.967	RNA binding motif protein 15B
7	61853.ENSNLEP00000010557	0.921	Cbl proto-oncogene-like 1, E3 ubiquitin protein ligase
8	61853.ENSNLEP00000022610	0.919	Zinc finger protein 645
9	61853.ENSNLEP00000009306	0.825	Spen family transcriptional repressor
10	61853.ENSNLEP00000018305	0.822	THO complex 2
11	61853.ENSNLEP00000020555	0.728	Nuclear cap binding protein subunit 1, 80kDa
12	61853.ENSNLEP00000011227	0.713	YTH domain containing 1
13	61853.ENSNLEP00000008365	0.699	Methyltransferase like 4
14	61853.ENSNLEP00000016920	0.699	AlkB family member 5, RNA demethylase
15	61853.ENSNLEP00000012157	0.698	Uncharacterized protein
16	61853.ENSNLEP00000004699	0.696	YTH N6-methyladenosine RNA binding protein 3
17	61853.ENSNLEP00000023822	0.694	DGCR8 microprocessor complex subunit
18	61853.ENSNLEP00000001383	0.693	FTO, alpha-ketoglutarate dependent dioxygenase
19	61853.ENSNLEP00000012012	0.693	YTH N6-methyladenosine RNA binding protein 2
20	61853.ENSNLEP00000000224	0.691	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008174	1.000	mRNA methyltransferase activity
GO:0016422	0.967	mRNA (2'-O-methyladenosine-N6-)-methyltransferase activity
GO:0097159	0.925	organic cyclic compound binding
GO:1901363	0.916	heterocyclic compound binding
GO:0003676	0.787	nucleic acid binding
GO:0003723	0.777	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:0044238	0.997	primary metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0050794	0.995	regulation of cellular process
GO:0034248	0.994	regulation of amide metabolic process
GO:2000112	0.993	regulation of cellular macromolecule biosynthetic process
GO:0090304	0.991	nucleic acid metabolic process
GO:0016070	0.984	RNA metabolic process
GO:0080090	0.977	regulation of primary metabolic process
GO:0010468	0.977	regulation of gene expression
GO:0044260	0.964	cellular macromolecule metabolic process
GO:0043412	0.960	macromolecule modification
GO:0006417	0.955	regulation of translation
GO:0016071	0.946	mRNA metabolic process
GO:0043414	0.933	macromolecule methylation
GO:0001510	0.923	RNA methylation
GO:0010604	0.921	positive regulation of macromolecule metabolic process
GO:0031325	0.919	positive regulation of cellular metabolic process
GO:0051173	0.917	positive regulation of nitrogen compound metabolic process
GO:0016556	0.912	mRNA modification
GO:1901532	0.909	regulation of hematopoietic progenitor cell differentiation
GO:0048523	0.908	negative regulation of cellular process
GO:0019219	0.867	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.857	regulation of RNA metabolic process
GO:1903311	0.680	regulation of mRNA metabolic process
GO:0010467	0.678	gene expression
GO:0006396	0.432	RNA processing
GO:0045596	0.371	negative regulation of cell differentiation
GO:0010605	0.349	negative regulation of macromolecule metabolic process
GO:0045935	0.311	positive regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0036396	1.000	RNA N6-methyladenosine methyltransferase complex
GO:0005654	0.999	nucleoplasm
GO:0005737	0.516	cytoplasm
GO:0005829	0.486	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	1.000	Methyltransferases.
RHEA:22744	0.967	a 5'-end (N(7)-methyl 5'-triphosphoguanosine)-(2'-O-methyladenosine) in mRNA + S-adenosyl-L-methionine = a 5'-end (N(7)-methyl 5'-triphosphoguanosine)-(N(6),2'-O-dimethyladenosine) in mRNA + H(+) + S-adenosyl-L-homocysteine
EC:2.1.1.62	0.967	mRNA (2'-O-methyladenosine-N(6)-)-methyltransferase.

[back to server]