StarFunc result for job id Q9HCE6

User Input

>input (1279 residues)
MASSNPPPQPAIGDQLVPGVPGPSSEAEDDPGEAFEFDDSDDEEDTSAALGVPSLAPERD
TDPPLIHLDSIPVTDPDPAAAPPGTGVPAWVSNGDAADAAFSGARHSSWKRKSSRRIDRF
TFPALEEDVIYDDVPCESPDAHQPGAERNLLYEDAHRAGAPRQAEDLGWSSSEFESYSED
SGEEAKPEVEVEPAKHRVSFQPKLSPDLTRLKERYARTKRDILALRVGGRDMQELKHKYD
CKMTQLMKAAKSGTKDGLEKTRMAVMRKVSFLHRKDVLGDSEEEDMGLLEVSVSDIKPPA
PELGPMPEGLSPQQVVRRHILGSIVQSEGSYVESLKRILQDYRNPLMEMEPKALSARKCQ
VVFFRVKEILHCHSMFQIALSSRVAEWDSTEKIGDLFVASFSKSMVLDVYSDYVNNFTSA
MSIIKKACLTKPAFLEFLKRRQVCSPDRVTLYGLMVKPIQRFPQFILLLQDMLKNTPRGH
PDRLSLQLALTELETLAEKLNEQKRLADQVAEIQQLTKSVSDRSSLNKLLTSGQRQLLLC
ETLTETVYGDRGQLIKSKERRVFLLNDMLVCANINFKPANHRGQLEISSLVPLGPKYVVK
WNTALPQVQVVEVGQDGGTYDKDNVLIQHSGAKKASASGQAQNKVYLGPPRLFQELQDLQ
KDLAVVEQITLLISTLHGTYQNLNMTVAQDWCLALQRLMRVKEEEIHSANKCRLRLLLPG
KPDKSGRPISFMVVFITPNPLSKISWVNRLHLAKIGLREENQPGWLCPDEDKKSKAPFWC
PILACCIPAFSSRALSLQLGALVHSPVNCPLLGFSAVSTSLPQGYLWVGGGQEGAGGQVE
IFSLNRPSPRTVKSFPLAAPVLCMEYIPELEEEAESRDESPTVADPSATVHPTICLGLQD
GSILLYSSVDTGTQCLVSCRSPGLQPVLCLRHSPFHLLAGLQDGTLAAYPRTSGGVLWDL
ESPPVCLTVGPGPVRTLLSLEDAVWASCGPRVTVLEATTLQPQQSFEAHQDEAVSVTHMV
KAGSGVWMAFSSGTSIRLFHTETLEHLQEINIATRTTFLLPGQKHLCVTSLLICQGLLWV
GTDQGVIVLLPVPRLEGIPKITGKGMVSLNGHCGPVAFLAVATSILAPDILRSDQEEAEG
PRAEEDKPDGQAHEPMPDSHVGRELTRKKGILLQYRLRSTAHLPGPLLSMREPAPADGAA
LEHSEEDGSIYEMADDPDIWVRSRPCARDAHRKEICSVAIISGGQGYRNFGSALGSSGRQ
APCGETDSTLLIWQVPLML

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HCE6	1.000	1.000	0.000	1279	1.000	1.000	Q9HCE6.pdb.gz	ARGAL_HUMAN Rho guanine nucleotide exchange factor 10-like protein OS=Homo sapiens OX=9606 GN=ARHGEF10L PE=1 SV=4
2	AFDB:Q9Y7U5	0.242	0.243	7.924E-21	1275	0.126	0.126	Q9Y7U5.pdb.gz	RGF3_SCHPO Rho1 guanine nucleotide exchange factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rgf3 PE=1 SV=1
3	AFDB:Q6ZNL6	0.144	0.127	2.824E-13	1462	0.111	0.097	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
4	AFDB:D3DTR7	0.197	0.289	3.079E-13	841	0.098	0.149	D3DTR7.pdb.gz
5	AFDB:E9Q7D5	0.208	0.171	3.661E-13	1581	0.099	0.080	E9Q7D5.pdb.gz	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
6	AFDB:F7BYT9	0.223	0.229	3.018E-11	1245	0.089	0.092	F7BYT9.pdb.gz	F7BYT9_MACMU Rho guanine nucleotide exchange factor 2 OS=Macaca mulatta OX=9544 GN=ARHGEF2 PE=4 SV=3
7	PDB:7rx9A	0.142	0.407	1.220E-10	432	0.058	0.171	7rx9A.pdb.gz
8	PDB:4mt6A	0.189	0.509	1.330E-10	389	0.052	0.170	4mt6A.pdb.gz
9	AFDB:Q13009	0.153	0.130	3.226E-9	1591	0.080	0.064	Q13009.pdb.gz	TIAM1_HUMAN Rho guanine nucleotide exchange factor TIAM1 OS=Homo sapiens OX=9606 GN=TIAM1 PE=1 SV=2
10	AFDB:P97499	0.126	0.071	8.355E-9	2629	0.073	0.036	P97499.pdb.gz	TEP1_MOUSE Telomerase protein component 1 OS=Mus musculus OX=10090 GN=Tep1 PE=1 SV=1
11	PDB:6xr4A	0.177	0.216	1.006E-8	1040	0.044	0.054	6xr4A.pdb.gz
12	PDB:6ttuT	0.174	0.536	1.690E-8	394	0.031	0.102	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
13	AFDB:Q6TXD4	0.153	0.125	4.515E-8	1580	0.074	0.060	Q6TXD4.pdb.gz	DNMBP_MOUSE Dynamin-binding protein OS=Mus musculus OX=10090 GN=Dnmbp PE=1 SV=2
14	PDB:7lhwA	0.205	0.148	7.356E-8	1813	0.056	0.039	7lhwA.pdb.gz	Structural analysis of the full-length human LRRK2.
15	PDB:7bt6x	0.160	0.378	8.021E-8	488	0.040	0.105	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
16	PDB:4pswB	0.185	0.589	9.133E-8	366	0.033	0.115	4pswB.pdb.gz	Hat2p recognizes the histone H3 tail to specify the acetylation of the newly synthesized H3/H4 heterodimer by the Hat1p/Hat2p complex
17	PDB:5nnzA	0.172	0.562	1.134E-7	335	0.032	0.122	5nnzA.pdb.gz
18	PDB:7apkC	0.183	0.708	1.134E-7	304	0.034	0.141	7apkC.pdb.gz
19	PDB:7mqaLQ	0.142	0.215	1.134E-7	830	0.024	0.037	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	AFDB:D1MYR8	0.225	0.277	2.313E-6	1007	0.127	0.161	D1MYR8.pdb.gz	D1MYR8_9HYPO Guanine-nucleotide exchange factor Cdc24 OS=Epichloe festucae OX=35717 GN=Cdc24 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O15013	0.0	917	1369	0.420	0.392	ARHGA_HUMAN Rho guanine nucleotide exchange factor 10 OS=Homo sapiens OX=9606 GN=ARHGEF10 PE=1 SV=4
2	Q9HCE6	0.0	2622	1279	1.000	1.000	ARGAL_HUMAN Rho guanine nucleotide exchange factor 10-like protein OS=Homo sapiens OX=9606 GN=ARHGEF10L PE=1 SV=4
3	Q9VX48	5.73e-113	389	1458	0.222	0.195	Q9VX48_DROME SD02996p OS=Drosophila melanogaster OX=7227 GN=CG12432 PE=1 SV=2
4	E1JJN5	2.36e-112	390	1736	0.222	0.164	E1JJN5_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=CG8557 PE=1 SV=2
5	M9PEZ9	3.88e-112	388	1563	0.222	0.182	M9PEZ9_DROME Uncharacterized protein, isoform F OS=Drosophila melanogaster OX=7227 GN=CG8557 PE=1 SV=1
6	M9PHU0	2.05e-111	389	2263	0.222	0.125	M9PHU0_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG12432 PE=1 SV=1
7	Q922V5	2.75e-104	329	185	0.127	0.881	Q922V5_MOUSE Arhgef10l protein (Fragment) OS=Mus musculus OX=10090 GN=Arhgef10l PE=2 SV=1
8	Q96PE2	8.16e-39	161	2063	0.111	0.069	ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1
9	Q21653	1.72e-27	123	1182	0.068	0.074	OSG1_CAEEL Rho guanine nucleotide exchange factor osg-1 OS=Caenorhabditis elegans OX=6239 GN=osg-1 PE=2 SV=4
10	Q1ZXH8	1.18e-26	121	1632	0.067	0.053	GXCDD_DICDI Guanine exchange factor for Rac 30 OS=Dictyostelium discoideum OX=44689 GN=gxcDD PE=4 SV=3
11	E9PSK7	2.09e-25	117	1322	0.065	0.063	JIP3_RAT C-Jun-amino-terminal kinase-interacting protein 3 OS=Rattus norvegicus OX=10116 GN=Mapk8ip3 PE=1 SV=2
12	Q9ESN9	2.37e-25	117	1337	0.062	0.059	JIP3_MOUSE C-Jun-amino-terminal kinase-interacting protein 3 OS=Mus musculus OX=10090 GN=Mapk8ip3 PE=1 SV=1
13	P34609	7.13e-25	115	1190	0.051	0.055	JIP_CAEEL JNK-interacting protein OS=Caenorhabditis elegans OX=6239 GN=unc-16 PE=1 SV=4
14	Q9UPT6	1.55e-24	114	1336	0.063	0.060	JIP3_HUMAN C-Jun-amino-terminal kinase-interacting protein 3 OS=Homo sapiens OX=9606 GN=MAPK8IP3 PE=1 SV=3
15	L7RKJ8	3.49e-24	113	1299	0.055	0.054	L7RKJ8_DANRE C-Jun-amino-terminal kinase-interacting protein 3 OS=Danio rerio OX=7955 GN=mapk8ip3 PE=2 SV=1
16	O60271	1.66e-22	107	1321	0.051	0.049	JIP4_HUMAN C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9 PE=1 SV=4
17	Q9GQF1	1.73e-22	107	1227	0.059	0.061	JIP3_DROME JNK-interacting protein 3 OS=Drosophila melanogaster OX=7227 GN=syd PE=1 SV=1
18	F1LXF1	2.53e-22	107	1270	0.062	0.062	BCR_RAT Breakpoint cluster region protein OS=Rattus norvegicus OX=10116 GN=Bcr PE=1 SV=4
19	A0A8I6AXC7	2.77e-22	106	1305	0.051	0.050	A0A8I6AXC7_RAT Sperm associated antigen 9 OS=Rattus norvegicus OX=10116 GN=Spag9 PE=1 SV=1
20	Q58A65	2.94e-22	106	1321	0.049	0.048	JIP4_MOUSE C-Jun-amino-terminal kinase-interacting protein 4 OS=Mus musculus OX=10090 GN=Spag9 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19534 DUF6059	3.3e+02	13.3	Family of unknown function (DUF6059)
2	PF16453 IQ_SEC7_PH	9	17.6	PH domain
3	PF19057 PH_19	4.2e-46	167.8	PH domain
4	PF00621 RhoGEF	5.2e-36	136.1	RhoGEF domain
5	PF19056 WD40_2	4.3e-200	677.1	WD40 repeated domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355060

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.953	Transforming protein RhoA
2	9606.ENSP00000396620	0.674	Nuclear transcription factor Y subunit gamma
3	9606.ENSP00000263674	0.609	Rho guanine nucleotide exchange factor 17
4	9606.ENSP00000471635	0.539	Uncharacterized protein
5	9606.ENSP00000367355	0.533	Rho guanine nucleotide exchange factor 35
6	9606.ENSP00000279068	0.529	Protein LSM14 homolog B
7	9606.ENSP00000357177	0.525	Rho guanine nucleotide exchange factor 11
8	9606.ENSP00000439625	0.522	Pleckstrin homology domain-containing family G member 5
9	9606.ENSP00000339850	0.516	Dihydropyrimidinase-related protein 4
10	9606.ENSP00000328083	0.514	Rho guanine nucleotide exchange factor 37
11	9606.ENSP00000441913	0.509	Rho guanine nucleotide exchange factor 28

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005096	1.000	GTPase activator activity
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0005515	0.995	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.993	cellular process
GO:0050896	0.965	response to stimulus
GO:0033043	0.960	regulation of organelle organization
GO:0010646	0.959	regulation of cell communication
GO:0023051	0.952	regulation of signaling
GO:0051493	0.948	regulation of cytoskeleton organization
GO:1902903	0.941	regulation of supramolecular fiber organization
GO:0032956	0.941	regulation of actin cytoskeleton organization
GO:0009966	0.937	regulation of signal transduction
GO:0051056	0.931	regulation of small GTPase mediated signal transduction
GO:0110053	0.921	regulation of actin filament organization
GO:0051716	0.920	cellular response to stimulus
GO:0007154	0.913	cell communication
GO:0048522	0.912	positive regulation of cellular process
GO:0044087	0.903	regulation of cellular component biogenesis
GO:0007165	0.895	signal transduction
GO:0110020	0.884	regulation of actomyosin structure organization
GO:0051495	0.867	positive regulation of cytoskeleton organization
GO:0032231	0.825	regulation of actin filament bundle assembly
GO:1902905	0.801	positive regulation of supramolecular fiber organization
GO:0044089	0.706	positive regulation of cellular component biogenesis
GO:0051496	0.689	positive regulation of stress fiber assembly
GO:0006984	0.465	ER-nucleus signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.933	organelle
GO:0043229	0.816	intracellular organelle
GO:0043227	0.577	membrane-bounded organelle
GO:0016020	0.383	membrane
GO:0071944	0.357	cell periphery
GO:0043228	0.322	non-membrane-bounded organelle
GO:0043232	0.308	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]