StarFunc result for job id Q9HCE7

User Input

>input (757 residues)
MSNPGTRRNGSSIKIRLTVLCAKNLAKKDFFRLPDPFAKIVVDGSGQCHSTDTVKNTLDP
KWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAISRLKDTGYQRLDLCK
LNPSDTDAVRGQIVVSLQTRDRIGTGGSVVDCRGLLENEGTVYEDSGPGRPLSCFMEEPA
PYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGY
EQRTTVQGQVYFLHTQTGVSTWHDPRIPSPSGTIPGGDAAFLYEFLLQGHTSEPRDLNSV
NCDELGPLPPGWEVRSTVSGRIYFVDHNNRTTQFTDPRLHHIMNHQCQLKEPSQPLPLPS
EGSLEDEELPAQRYERDLVQKLKVLRHELSLQQPQAGHCRIEVSREEIFEESYRQIMKMR
PKDLKKRLMVKFRGEEGLDYGGVAREWLYLLCHEMLNPYYGLFQYSTDNIYMLQINPDSS
INPDHLSYFHFVGRIMGLAVFHGHYINGGFTVPFYKQLLGKPIQLSDLESVDPELHKSLV
WILENDITPVLDHTFCVEHNAFGRILQHELKPNGRNVPVTEENKKEYVRLYVNWRFMRGI
EAQFLALQKGFNELIPQHLLKPFDQKELELIIGGLDKIDLNDWKSNTRLKHCVADSNIVR
WFWQAVETFDEERRARLLQFVTGSTRVPLQGFKALQGSTGAAGPRLFTIHLIDANTDNLP
KAHTCFNRIDIPPYESYEKLYEKLLTAVEETCGFAVE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K612	0.531	0.549	0.000	731	0.952	0.986	A0A0G2K612.pdb.gz	A0A0G2K612_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Smurf1 PE=4 SV=2
2	AFDB:Q9CUN6	0.550	0.569	0.000	731	0.952	0.986	Q9CUN6.pdb.gz	SMUF1_MOUSE E3 ubiquitin-protein ligase SMURF1 OS=Mus musculus OX=10090 GN=Smurf1 PE=1 SV=2
3	AFDB:A2A5Z6	0.430	0.435	5.146E-102	748	0.750	0.759	A2A5Z6.pdb.gz	SMUF2_MOUSE E3 ubiquitin-protein ligase SMURF2 OS=Mus musculus OX=10090 GN=Smurf2 PE=1 SV=1
4	AFDB:Q9V853	0.498	0.357	1.439E-84	1061	0.601	0.429	Q9V853.pdb.gz	SMUF1_DROME E3 ubiquitin-protein ligase Smurf1 OS=Drosophila melanogaster OX=7227 GN=Smurf PE=1 SV=3
5	AFDB:O14326	0.482	0.465	4.520E-72	786	0.367	0.354	O14326.pdb.gz	PUB3_SCHPO E3 ubiquitin-protein ligase pub3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub3 PE=2 SV=1
6	AFDB:Q9N2Z7	0.336	0.321	2.863E-63	794	0.358	0.341	Q9N2Z7.pdb.gz	WWP1_CAEEL E3 ubiquitin-protein ligase wwp-1 OS=Caenorhabditis elegans OX=6239 GN=wwp-1 PE=1 SV=2
7	AFDB:Q96J02	0.341	0.287	5.893E-63	903	0.399	0.334	Q96J02.pdb.gz	ITCH_HUMAN E3 ubiquitin-protein ligase Itchy homolog OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=2
8	AFDB:Q9Y0H4	0.340	0.273	1.114E-61	949	0.382	0.305	Q9Y0H4.pdb.gz	SUDX_DROME E3 ubiquitin-protein ligase Su(dx) OS=Drosophila melanogaster OX=7227 GN=Su(dx) PE=1 SV=1
9	AFDB:K7WBL1	0.337	0.299	1.442E-61	856	0.373	0.329	K7WBL1.pdb.gz	K7WBL1_9CRUS E3 ubiquitin-protein ligase OS=Artemia sinica OX=112780 PE=2 SV=1
10	AFDB:Q9H0M0	0.337	0.278	1.077E-60	922	0.391	0.321	Q9H0M0.pdb.gz	WWP1_HUMAN NEDD4-like E3 ubiquitin-protein ligase WWP1 OS=Homo sapiens OX=9606 GN=WWP1 PE=1 SV=1
11	PDB:7jq9A	0.328	0.107	2.152E-33	2427	0.222	0.069	7jq9A.pdb.gz
12	PDB:7mopA	0.318	0.103	1.693E-32	2445	0.221	0.068	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
13	PDB:5ixcA	0.146	0.161	9.970E-8	684	0.028	0.031	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
14	PDB:1cjyA	0.141	0.167	1.105E-7	633	0.032	0.038	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
15	PDB:6kxkD	0.144	0.191	1.164E-7	553	0.038	0.052	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
16	PDB:5izrC	0.138	0.158	1.430E-7	659	0.028	0.032	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
17	PDB:5iz5B	0.144	0.146	1.670E-7	746	0.029	0.029	5iz5B.pdb.gz
18	PDB:5a50A	0.143	0.563	2.944E-7	165	0.038	0.176	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
19	PDB:4rj9A	0.135	0.565	8.259E-7	161	0.038	0.180	4rj9A.pdb.gz
20	PDB:5iz5A	0.137	0.137	9.156E-7	757	0.028	0.028	5iz5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K105	0.0	1430	709	0.923	0.986	A0A0G2K105_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Smurf1 PE=4 SV=1
2	A0A0G2K612	0.0	1553	757	0.985	0.985	A0A0G2K612_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Smurf1 PE=4 SV=2
3	A0A8I5Y0P5	0.0	1122	756	0.734	0.735	A0A8I5Y0P5_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Smurf2 PE=1 SV=1
4	A0A8I5ZK23	0.0	1425	706	0.911	0.977	A0A8I5ZK23_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Smurf1 PE=4 SV=1
5	A0A8I5ZUV2	0.0	731	695	0.485	0.528	A0A8I5ZUV2_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Smurf2 PE=1 SV=1
6	A0A8I6A1F1	0.0	1103	735	0.733	0.755	A0A8I6A1F1_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Smurf2 PE=1 SV=1
7	A2A5Z6	0.0	1138	748	0.757	0.766	SMUF2_MOUSE E3 ubiquitin-protein ligase SMURF2 OS=Mus musculus OX=10090 GN=Smurf2 PE=1 SV=1
8	D3ZCF5	0.0	1451	718	0.935	0.986	D3ZCF5_RAT HECT-type E3 ubiquitin transferase OS=Rattus norvegicus OX=10116 GN=Smurf1 PE=4 SV=3
9	F1M3F2	0.0	1142	748	0.750	0.759	F1M3F2_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Smurf2 PE=4 SV=3
10	J3QQM4	0.0	779	561	0.527	0.711	J3QQM4_HUMAN HECT-type E3 ubiquitin transferase (Fragment) OS=Homo sapiens OX=9606 GN=SMURF2 PE=1 SV=1
11	Q92462	0.0	545	767	0.429	0.424	PUB1_SCHPO E3 ubiquitin-protein ligase pub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub1 PE=1 SV=2
12	Q9CUN6	0.0	1487	731	0.952	0.986	SMUF1_MOUSE E3 ubiquitin-protein ligase SMURF1 OS=Mus musculus OX=10090 GN=Smurf1 PE=1 SV=2
13	Q9HAU4	0.0	1138	748	0.750	0.759	SMUF2_HUMAN E3 ubiquitin-protein ligase SMURF2 OS=Homo sapiens OX=9606 GN=SMURF2 PE=1 SV=1
14	Q9HCE7	0.0	1578	757	1.000	1.000	SMUF1_HUMAN E3 ubiquitin-protein ligase SMURF1 OS=Homo sapiens OX=9606 GN=SMURF1 PE=1 SV=2
15	Q9PUN2	0.0	1362	731	0.876	0.907	SMUF1_XENLA E3 ubiquitin-protein ligase SMURF1 OS=Xenopus laevis OX=8355 GN=smurf1 PE=2 SV=1
16	Q9V853	0.0	613	1061	0.374	0.267	SMUF1_DROME E3 ubiquitin-protein ligase Smurf1 OS=Drosophila melanogaster OX=7227 GN=Smurf PE=1 SV=3
17	Q5BDP1	3.68e-164	496	821	0.404	0.373	RSP5_EMENI E3 ubiquitin-protein ligase RSP5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=hulA PE=1 SV=1
18	P39940	2.42e-163	494	809	0.406	0.379	RSP5_YEAST E3 ubiquitin-protein ligase RSP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSP5 PE=1 SV=1
19	A0A590UJW8	6.08e-156	475	830	0.328	0.299	A0A590UJW8_HUMAN E3 ubiquitin-protein ligase OS=Homo sapiens OX=9606 GN=ITCH PE=1 SV=1
20	U6C7R6	7.20e-155	474	867	0.322	0.281	U6C7R6_DANRE E3 ubiquitin-protein ligase OS=Danio rerio OX=7955 GN=itcha PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	8.7e-13	59.8	C2 domain
2	PF00632 HECT	2e-88	308.4	HECT-domain (ubiquitin-transferase)
3	PF14761 HPS3_N	6.9e+02	11.1	Hermansky-Pudlak syndrome 3
4	PF00397 WW	1.3e-13	62.0	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354621

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262158	0.999	Mothers against decapentaplegic homolog 7
2	9606.ENSP00000288840	0.999	Mothers against decapentaplegic homolog 6
3	9606.ENSP00000426568	0.999	Mothers against decapentaplegic homolog 1
4	9606.ENSP00000400175	0.998	Transforming protein RhoA
5	9606.ENSP00000441954	0.997	Mothers against decapentaplegic homolog 5
6	9606.ENSP00000364133	0.995	TGF-beta receptor type-1
7	9606.ENSP00000262160	0.990	Mothers against decapentaplegic homolog 2
8	9606.ENSP00000348099	0.990	PDZ and LIM domain protein 7
9	9606.ENSP00000262435	0.987	E3 ubiquitin-protein ligase SMURF2
10	9606.ENSP00000219255	0.986	Partitioning defective 6 homolog alpha
11	9606.ENSP00000332973	0.986	Mothers against decapentaplegic homolog 3
12	9606.ENSP00000341551	0.986	Mothers against decapentaplegic homolog 4
13	9606.ENSP00000370503	0.976	Cerebral cavernous malformations 2 protein
14	9606.ENSP00000351905	0.975	TGF-beta receptor type-2
15	9606.ENSP00000358120	0.973	Pleckstrin homology domain-containing family O member 1
16	9606.ENSP00000401907	0.971	Bone morphogenetic protein receptor type-1B
17	9606.ENSP00000363708	0.965	Bone morphogenetic protein receptor type-2
18	9606.ENSP00000361107	0.962	Bone morphogenetic protein receptor type-1A
19	9606.ENSP00000369154	0.962	Mothers against decapentaplegic homolog 9
20	9606.ENSP00000368104	0.958	Bone morphogenetic protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0061659	0.994	ubiquitin-like protein ligase activity
GO:0061630	0.981	ubiquitin protein ligase activity
GO:0005102	0.519	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0009987	0.995	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0048518	0.989	positive regulation of biological process
GO:0050793	0.980	regulation of developmental process
GO:0048522	0.976	positive regulation of cellular process
GO:0051128	0.953	regulation of cellular component organization
GO:0071840	0.952	cellular component organization or biogenesis
GO:0016043	0.914	cellular component organization
GO:0071704	0.911	organic substance metabolic process
GO:0044238	0.910	primary metabolic process
GO:0006807	0.889	nitrogen compound metabolic process
GO:0043170	0.872	macromolecule metabolic process
GO:0050896	0.862	response to stimulus
GO:0048583	0.819	regulation of response to stimulus
GO:0051239	0.810	regulation of multicellular organismal process
GO:0048523	0.776	negative regulation of cellular process
GO:0019222	0.721	regulation of metabolic process
GO:1901564	0.718	organonitrogen compound metabolic process
GO:0009966	0.717	regulation of signal transduction
GO:0019538	0.708	protein metabolic process
GO:0022603	0.707	regulation of anatomical structure morphogenesis
GO:0051716	0.691	cellular response to stimulus
GO:0051094	0.651	positive regulation of developmental process
GO:0043412	0.639	macromolecule modification
GO:0036211	0.622	protein modification process
GO:0060255	0.581	regulation of macromolecule metabolic process
GO:0040008	0.555	regulation of growth
GO:0051171	0.524	regulation of nitrogen compound metabolic process
GO:0007165	0.519	signal transduction
GO:0080090	0.487	regulation of primary metabolic process
GO:0032502	0.485	developmental process
GO:0009893	0.453	positive regulation of metabolic process
GO:0031323	0.440	regulation of cellular metabolic process
GO:0048856	0.416	anatomical structure development
GO:0070647	0.416	protein modification by small protein conjugation or removal
GO:0044237	0.390	cellular metabolic process
GO:0010604	0.355	positive regulation of macromolecule metabolic process
GO:0001558	0.351	regulation of cell growth
GO:0045595	0.344	regulation of cell differentiation
GO:0051173	0.339	positive regulation of nitrogen compound metabolic process
GO:0030307	0.328	positive regulation of cell growth
GO:0032446	0.316	protein modification by small protein conjugation
GO:0009968	0.313	negative regulation of signal transduction
GO:0065008	0.305	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043227	0.996	membrane-bounded organelle
GO:0043231	0.982	intracellular membrane-bounded organelle
GO:0016020	0.975	membrane
GO:0005634	0.947	nucleus
GO:0070013	0.943	intracellular organelle lumen
GO:0005654	0.907	nucleoplasm
GO:0071944	0.852	cell periphery
GO:0005886	0.813	plasma membrane
GO:0031982	0.800	vesicle
GO:0043005	0.637	neuron projection
GO:0005576	0.629	extracellular region
GO:0044297	0.607	cell body
GO:0032991	0.572	protein-containing complex
GO:0005615	0.511	extracellular space
GO:0036477	0.375	somatodendritic compartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]