StarFunc result for job id Q9HCE9

User Input

>input (1232 residues)
MAEAASGAGGTSLEGERGKRPPPEGEPAAPASGVLDKLFGKRLLQAGRYLVSHKAWMKTV
PTENCDVLMTFPDTTDDHTLLWLLNHIRVGIPELIVQVRHHRHTRAYAFFVTATYESLLR
GADELGLRKAVKAEFGGGTRGFSCEEDFIYENVESELRFFTSQERQSIIRFWLQNLRAKQ
GEALHNVRFLEDQPIIPELAARGIIQQVFPVHEQRILNRLMKSWVQAVCENQPLDDICDY
FGVKIAMYFAWLGFYTSAMVYPAVFGSVLYTFTEADQTSRDVSCVVFALFNVIWSTLFLE
EWKRRGAELAYKWGTLDSPGEAVEEPRPQFRGVRRISPITRAEEFYYPPWKRLLFQLLVS
LPLCLACLVCVFLLMLGCFQLQELVLSVKGLPRLARFLPKVMLALLVSVSAEGYKKLAIW
LNDMENYRLESAYEKHLIIKVVLFQFVNSYLSLFYIGFYLKDMERLKEMLATLLITRQFL
QNVREVLQPHLYRRLGRGELGLRAVWELARALLGLLSLRRPAPRRLEPQADEGGGGGSGG
GGRRCLSGGCGAPEEEEEAALVERRRAGEGGEEGDGPPGGKEEDEDDEEEEDEEEEEDEE
EGEEGGLLDCGLRLKKVSFAERGAGRRRPGPSPEALLEEGSPTMVEKGLEPGVFTLAEED
DEAEGAPGSPEREPPAILFRRAGGEGRDQGPDGGPDPEPGSNSDSTRRQRRQNRSSWIDP
PEEEHSPQLTQAELESCMKKYEDTFQDYQEMFVQFGYVVLFSSAFPLAALCALVNNLIEI
RSDAFKLCTGLQRPFGQRVESIGQWQKVMEAMGVLAIVVNCYLIGQCGQLQRLFPWLSPE
AAIVSVVVLEHFALLLKYLIHVAIPDIPGWVAEEMAKLEYQRREAFKRHERQAQHRYQQQ
QRRRREEEERQRHAEHHARREHDSGGREEARAEGSGLDPATSSEKASAKAKGSTAGGHGP
ERPKRPGSLLAPNNVMKLKQIIPLQGKFLSSGATSSLAAAGAGATTRPPPAQSPTGSDTR
LPAFLSFKFLKSPETRRDSERSHSPPKAFHAGKLFPFGGTRAEPGSNGAGGQARPDGTPS
SGSSRVQRSGPVDEALAEELEAPRPEEEGSGTALAPVGAPALRTRRSRSPAPPPPMPLPR
PPTPPAGCWQWDGPWGCGGEGAAPRQALAAAECPPCAMAGPPPAPQPLPGDASFYSLPPP
PLPPTSDPLETPAPSPSPSPSPQAVCWPSGWH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HCE9	0.999	0.999	0.000	1232	1.000	1.000	Q9HCE9.pdb.gz	ANO8_HUMAN Anoctamin-8 OS=Homo sapiens OX=9606 GN=ANO8 PE=1 SV=3
2	PDB:6r7xA	0.462	0.891	1.878E-37	629	0.188	0.367	6r7xA.pdb.gz	The structural basis of lipid scrambling and inactivation in the endoplasmic reticulum scramblase TMEM16K.
3	PDB:8b8kA	0.406	0.658	8.641E-23	741	0.131	0.217	8b8kA.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
4	PDB:6qm5A	0.375	0.648	1.402E-20	673	0.134	0.245	6qm5A.pdb.gz	Stepwise activation mechanism of the scramblase nhTMEM16 revealed by cryo-EM.
5	PDB:6oy3B	0.397	0.789	2.111E-20	594	0.123	0.256	6oy3B.pdb.gz	Dynamic modulation of the lipid translocation groove generates a conductive ion channel in Ca 2+ -bound nhTMEM16.
6	PDB:7rxgB	0.394	0.710	3.178E-20	650	0.116	0.220	7rxgB.pdb.gz	TMEM16 scramblases thin the membrane to enable lipid scrambling.
7	PDB:7zk3A	0.393	0.652	3.480E-20	721	0.116	0.198	7zk3A.pdb.gz	Inhibition mechanism of the chloride channel TMEM16A by the pore blocker 1PBC.
8	PDB:7rx2B	0.386	0.739	5.737E-20	615	0.116	0.233	7rx2B.pdb.gz	TMEM16 scramblases thin the membrane to enable lipid scrambling.
9	PDB:7rx3B	0.380	0.759	1.036E-19	591	0.112	0.234	7rx3B.pdb.gz	TMEM16 scramblases thin the membrane to enable lipid scrambling.
10	PDB:8b8jA	0.363	0.611	1.134E-19	709	0.135	0.234	8b8jA.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
11	PDB:8bc0B	0.353	0.664	1.631E-19	636	0.127	0.247	8bc0B.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
12	AFDB:D3KZG3	0.195	0.188	4.144E-8	1285	0.127	0.121	D3KZG3.pdb.gz	TMC1_CAEEL Transmembrane channel-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=tmc-1 PE=1 SV=2
13	AFDB:E1JGL8	0.050	0.049	1.546E-1	1272	0.071	0.069	E1JGL8.pdb.gz	E1JGL8_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Dmel\CG30122 PE=1 SV=1
14	AFDB:F4KE59	0.030	0.029	1.940E-1	1311	0.080	0.076	F4KE59.pdb.gz	PAIP2_ARATH Protein PARALOG OF AIPP2 OS=Arabidopsis thaliana OX=3702 GN=PAIPP2 PE=1 SV=1
15	AFDB:Q59W62	0.053	0.049	2.030E-1	1349	0.095	0.087	Q59W62.pdb.gz	GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GIN4 PE=1 SV=1
16	AFDB:P54253	0.027	0.037	3.056E-1	815	0.088	0.133	P54253.pdb.gz	ATX1_HUMAN Ataxin-1 OS=Homo sapiens OX=9606 GN=ATXN1 PE=1 SV=2
17	AFDB:Q961B0	0.049	0.054	3.056E-1	1067	0.109	0.126	Q961B0.pdb.gz	Q961B0_DROME LD24920p OS=Drosophila melanogaster OX=7227 GN=Apc2 PE=2 SV=1
18	AFDB:A0A0S2Z4R4	0.051	0.075	4.395E-1	777	0.073	0.116	A0A0S2Z4R4.pdb.gz	A0A0S2Z4R4_HUMAN Hepatocyte growth factor-regulated tyrosine kinase substrate (Fragment) OS=Homo sapiens OX=9606 GN=HGS PE=2 SV=1
19	AFDB:Q57ZN6	0.080	0.065	4.599E-1	1558	0.114	0.090	Q57ZN6.pdb.gz	Q57ZN6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27C5.80 PE=4 SV=1
20	AFDB:Q5I012	0.043	0.047	5.271E-1	1090	0.112	0.127	Q5I012.pdb.gz	S38AA_MOUSE Solute carrier family 38 member 10 OS=Mus musculus OX=10090 GN=Slc38a10 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HCE9	0.0	2489	1232	1.000	1.000	ANO8_HUMAN Anoctamin-8 OS=Homo sapiens OX=9606 GN=ANO8 PE=1 SV=3
2	Q8BH79	1.51e-62	228	659	0.122	0.228	ANO10_MOUSE Anoctamin-10 OS=Mus musculus OX=10090 GN=Ano10 PE=1 SV=1
3	Q9NW15	4.68e-61	224	660	0.121	0.226	ANO10_HUMAN Anoctamin-10 OS=Homo sapiens OX=9606 GN=ANO10 PE=1 SV=2
4	O97132	1.47e-43	171	646	0.079	0.150	O97132_DROME Anoctamin OS=Drosophila melanogaster OX=7227 GN=Axs PE=3 SV=1
5	A0A0B4JCY1	9.36e-30	130	1099	0.094	0.106	A0A0B4JCY1_DROME Anoctamin OS=Drosophila melanogaster OX=7227 GN=subdued PE=3 SV=1
6	Q9VDV4	9.45e-30	130	1075	0.094	0.108	Q9VDV4_DROME Anoctamin OS=Drosophila melanogaster OX=7227 GN=subdued PE=2 SV=1
7	Q86P24	9.71e-29	127	972	0.094	0.119	Q86P24_DROME Anoctamin (Fragment) OS=Drosophila melanogaster OX=7227 GN=subdued PE=2 SV=1
8	A0A0B4KGH4	2.65e-28	125	950	0.097	0.125	A0A0B4KGH4_DROME Anoctamin OS=Drosophila melanogaster OX=7227 GN=subdued PE=3 SV=1
9	Q8IN71	2.74e-28	125	926	0.096	0.127	Q8IN71_DROME Anoctamin OS=Drosophila melanogaster OX=7227 GN=subdued PE=3 SV=1
10	Q14AT5	3.29e-27	122	859	0.088	0.127	ANO7_MOUSE Anoctamin-7 OS=Mus musculus OX=10090 GN=Ano7 PE=1 SV=2
11	A0A8I5Y1S2	3.50e-26	119	924	0.084	0.111	A0A8I5Y1S2_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
12	A0A0G2K1M7	3.58e-26	119	909	0.084	0.113	A0A0G2K1M7_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
13	A0A8I6AA94	4.31e-26	118	932	0.084	0.111	A0A8I6AA94_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
14	A0A8I6ASC3	6.05e-26	118	888	0.084	0.116	A0A8I6ASC3_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
15	A0A8I6G530	6.10e-26	118	887	0.084	0.116	A0A8I6G530_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
16	C7Z7K1	6.49e-26	117	735	0.075	0.127	C7Z7K1_FUSV7 Plasma membrane channel protein OS=Fusarium vanettenii (strain ATCC MYA-4622 / CBS 123669 / FGSC 9596 / NRRL 45880 / 77-13-4) OX=660122 GN=NECHADRAFT_66456 PE=1 SV=1
17	A0A8I6AHD2	7.10e-26	117	865	0.084	0.119	A0A8I6AHD2_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
18	A0A8I5ZRU7	9.37e-26	117	911	0.084	0.113	A0A8I5ZRU7_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
19	F1QNZ8	1.03e-25	117	910	0.086	0.116	F1QNZ8_DANRE Anoctamin OS=Danio rerio OX=7955 GN=ano6 PE=3 SV=1
20	Q6P9J9	3.99e-25	115	911	0.083	0.112	ANO6_MOUSE Anoctamin-6 OS=Mus musculus OX=10090 GN=Ano6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04547 Anoctamin	8.2e-189	639.9	Calcium-activated chloride channel
2	PF00654 Voltage_CLC	4.1e+02	11.6	Voltage gated chloride channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000159087

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000472409	0.574	ARL14 effector protein-like
2	9606.ENSP00000484331	0.552	Melanoregulin
3	9606.ENSP00000268459	0.527	Protein naked cuticle homolog 1
4	9606.ENSP00000364515	0.510	BTB/POZ domain-containing protein 17
5	9606.ENSP00000268797	0.505	Glucose-fructose oxidoreductase domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005229	0.999	intracellular calcium activated chloride channel activity
GO:0005515	0.753	protein binding
GO:0022839	0.320	monoatomic ion gated channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0015698	0.989	inorganic anion transport
GO:0006821	0.976	chloride transport
GO:0034220	0.971	monoatomic ion transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.997	endomembrane system
GO:0070013	0.995	intracellular organelle lumen
GO:0005783	0.989	endoplasmic reticulum
GO:0005788	0.937	endoplasmic reticulum lumen
GO:0005654	0.335	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	0.999	chloride(in) = chloride(out)

[back to server]