StarFunc result for job id Q9HCF6

User Input

>input (1732 residues)
MPEPWGTVYFLGIAQVFSFLFSWWNLEGVMNQADAPRPLNWTIRKLCHAAFLPSVRLLKA
QKSWIERAFYKRECVHIIPSTKDPHRCCCGRLIGQHVGLTPSISVLQNEKNESRLSRNDI
QSEKWSISKHTQLSPTDAFGTIEFQGGGHSNKAMYVRVSFDTKPDLLLHLMTKEWQLELP
KLLISVHGGLQNFELQPKLKQVFGKGLIKAAMTTGAWIFTGGVNTGVIRHVGDALKDHAS
KSRGKICTIGIAPWGIVENQEDLIGRDVVRPYQTMSNPMSKLTVLNSMHSHFILADNGTT
GKYGAEVKLRRQLEKHISLQKINTRCLPFFSLDSRLFYSFWGSCQLDSVGIGQGVPVVAL
IVEGGPNVISIVLEYLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLV
TIQKTFTYTRTQAQHLFIILMECMKKKELITVFRMGSEGHQDIDLAILTALLKGANASAP
DQLSLALAWNRVDIARSQIFIYGQQWPVGSLEQAMLDALVLDRVDFVKLLIENGVSMHRF
LTISRLEELYNTRHGPSNTLYHLVRDVKKGNLPPDYRISLIDIGLVIEYLMGGAYRCNYT
RKRFRTLYHNLFGPKRPKALKLLGMEDDIPLRRGRKTTKKREEEVDIDLDDPEINHFPFP
FHELMVWAVLMKRQKMALFFWQHGEEAMAKALVACKLCKAMAHEASENDMVDDISQELNH
NSRDFGQLAVELLDQSYKQDEQLAMKLLTYELKNWSNATCLQLAVAAKHRDFIAHTCSQM
LLTDMWMGRLRMRKNSGLKVILGILLPPSILSLEFKNKDDMPYMSQAQEIHLQEKEAEEP
EKPTKEKEEEDMELTAMLGRNNGESSRKKDEEEVQSKHRLIPLGRKIYEFYNAPIVKFWF
YTLAYIGYLMLFNYIVLVKMERWPSTQEWIVISYIFTLGIEKMREILMSEPGKLLQKVKV
WLQEYWNVTDLIAILLFSVGMILRLQDQPFRSDGRVIYCVNIIYWYIRLLDIFGVNKYLG
PYVMMIGKMMIDMMYFVIIMLVVLMSFGVARQAILFPNEEPSWKLAKNIFYMPYWMIYGE
VFADQIDPPCGQNETREDGKIIQLPPCKTGAWIVPAIMACYLLVANILLVNLLIAVFNNT
FFEVKSISNQVWKFQRYQLIMTFHERPVLPPPLIIFSHMTMIFQHLCCRWRKHESDPDER
DYGLKLFITDDELKKVHDFEEQCIEEYFREKDDRFNSSNDERIRVTSERVENMSMRLEEV
NEREHSMKASLQTVDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYI
VRQSSFNSQEGNTFKLQESIDPAGEETMSPTSPTLMPRMRSHSFYSVNMKDKGGIEKLES
IFKERSLSLHRATSSHSVAKEPKAPAAPANTLAIVPDSRRPSSCIDIYVSAMDELHCDID
PLDNSVNILGLGEPSFSTPVPSTAPSSSAYATLAPTDRPPSRSIDFEDITSMDTRSFSSD
YTHLPECQNPWDSEPPMYHTIERSKSSRYLATTPFLLEEAPIVKSHSFMFSPSRSYYANF
GVPVKTAEYTSITDCIDTRCVNAPQAIADRAAFPGGLGDKVEDLTCCHPEREAELSHPSS
DSEENEAKGRRATIAISSQEGDNSERTLSNNITVPKIERANSYSAEEPSAPYAHTRKSFS
ISDKLDRQRNTASLRNPFQRSKSSKPEGRGDSLSMRRLSRTSAFQSFESKHN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z4N2	0.660	0.712	0.000	1603	0.568	0.614	Q7Z4N2.pdb.gz	TRPM1_HUMAN Transient receptor potential cation channel subfamily M member 1 OS=Homo sapiens OX=9606 GN=TRPM1 PE=1 SV=2
2	AFDB:Q8CIR4	0.631	0.541	0.000	2028	0.413	0.353	Q8CIR4.pdb.gz	TRPM6_MOUSE Transient receptor potential cation channel subfamily M member 6 OS=Mus musculus OX=10090 GN=Trpm6 PE=2 SV=1
3	AFDB:Q9BX84	0.640	0.549	0.000	2022	0.426	0.364	Q9BX84.pdb.gz	TRPM6_HUMAN Transient receptor potential cation channel subfamily M member 6 OS=Homo sapiens OX=9606 GN=TRPM6 PE=1 SV=2
4	AFDB:Q9HCF6	1.000	1.000	0.000	1732	1.000	1.000	Q9HCF6.pdb.gz	TRPM3_HUMAN Transient receptor potential cation channel subfamily M member 3 OS=Homo sapiens OX=9606 GN=TRPM3 PE=1 SV=4
5	PDB:6co7A	0.518	0.825	4.972E-69	1061	0.222	0.362	6co7A.pdb.gz	Structure of a TRPM2 channel in complex with Ca2+explains unique gating regulation.
6	PDB:6puuA	0.510	0.661	1.486E-63	1309	0.212	0.281	6puuA.pdb.gz	Ligand recognition and gating mechanism through three ligand-binding sites of human TRPM2 channel.
7	PDB:6bcqB	0.463	0.764	8.976E-56	983	0.184	0.323	6bcqB.pdb.gz	Structures of the calcium-activated, non-selective cation channel TRPM4.
8	PDB:6drjA	0.439	0.573	2.080E-55	1266	0.202	0.276	6drjA.pdb.gz	Architecture of the TRPM2 channel and its activation mechanism by ADP-ribose and calcium.
9	PDB:6pkxB	0.433	0.588	5.469E-52	1218	0.199	0.283	6pkxB.pdb.gz	Visualizing structural transitions of ligand-dependent gating of the TRPM2 channel.
10	PDB:6bqrA	0.454	0.783	1.062E-51	948	0.180	0.328	6bqrA.pdb.gz	Structure of the human TRPM4 ion channel in a lipid nanodisc.
11	PDB:6mj2A	0.468	0.586	1.155E-49	1337	0.212	0.274	6mj2A.pdb.gz	Structures and gating mechanism of human TRPM2.
12	PDB:5wp6A	0.444	0.734	4.345E-48	977	0.184	0.325	5wp6A.pdb.gz	Electron cryo-microscopy structure of a human TRPM4 channel.
13	PDB:8e4nA	0.419	0.755	5.409E-47	901	0.168	0.323	8e4nA.pdb.gz	Activation mechanism of the mouse cold-sensing TRPM8 channel by cooling agonist and PIP 2.
14	PDB:7wrbA	0.420	0.730	1.310E-46	930	0.169	0.314	7wrbA.pdb.gz	Structures of a mammalian TRPM8 in closed state.
15	AFDB:Q99246	0.120	0.099	5.718E-5	2179	0.098	0.078	Q99246.pdb.gz	CAC1D_MOUSE Voltage-dependent L-type calcium channel subunit alpha-1D OS=Mus musculus OX=10090 GN=Cacna1d PE=1 SV=3
16	AFDB:Q14152	0.061	0.069	9.302E-5	1382	0.106	0.133	Q14152.pdb.gz	EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1
17	AFDB:A0A0R4IFN9	0.105	0.082	1.016E-4	2319	0.090	0.067	A0A0R4IFN9.pdb.gz
18	AFDB:H8ESG1	0.052	0.057	1.973E-4	1494	0.093	0.108	H8ESG1.pdb.gz	H8ESG1_CAEEL BRO1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ego-2 PE=1 SV=1
19	AFDB:O95180	0.110	0.084	2.811E-4	2353	0.094	0.069	O95180.pdb.gz	CAC1H_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1H OS=Homo sapiens OX=9606 GN=CACNA1H PE=1 SV=4
20	AFDB:Q6PR54	0.073	0.061	4.366E-3	2419	0.095	0.068	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7T1N0	0.0	687	1551	0.252	0.282	TMP2L_NEMVE Transient receptor potential cation channel subfamily M member-like 2 OS=Nematostella vectensis OX=45351 GN=TRPM2 PE=1 SV=1
2	A8DYE2	0.0	1207	2023	0.355	0.304	TRPCG_DROME Transient receptor potential cation channel trpm OS=Drosophila melanogaster OX=7227 GN=Trpm PE=1 SV=1
3	Q20766	0.0	772	1406	0.261	0.321	Q20766_CAEEL LSDAT_euk domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gtl-2 PE=4 SV=5
4	Q2TV84	0.0	1240	1622	0.360	0.385	TRPM1_MOUSE Transient receptor potential cation channel subfamily M member 1 OS=Mus musculus OX=10090 GN=Trpm1 PE=1 SV=2
5	Q563W7	0.0	1483	1774	0.420	0.410	Q563W7_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=tct PE=2 SV=1
6	Q7Z4N2	0.0	1239	1603	0.383	0.414	TRPM1_HUMAN Transient receptor potential cation channel subfamily M member 1 OS=Homo sapiens OX=9606 GN=TRPM1 PE=1 SV=2
7	Q8CIR4	0.0	1310	2028	0.387	0.330	TRPM6_MOUSE Transient receptor potential cation channel subfamily M member 6 OS=Mus musculus OX=10090 GN=Trpm6 PE=2 SV=1
8	Q923J1	0.0	1507	1863	0.428	0.398	TRPM7_MOUSE Transient receptor potential cation channel subfamily M member 7 OS=Mus musculus OX=10090 GN=Trpm7 PE=1 SV=1
9	Q925B3	0.0	1501	1862	0.427	0.397	TRPM7_RAT Transient receptor potential cation channel subfamily M member 7 OS=Rattus norvegicus OX=10116 GN=Trpm7 PE=1 SV=2
10	Q96QT4	0.0	1497	1865	0.426	0.396	TRPM7_HUMAN Transient receptor potential cation channel subfamily M member 7 OS=Homo sapiens OX=9606 GN=TRPM7 PE=1 SV=1
11	Q9BX84	0.0	1369	2022	0.400	0.342	TRPM6_HUMAN Transient receptor potential cation channel subfamily M member 6 OS=Homo sapiens OX=9606 GN=TRPM6 PE=1 SV=2
12	Q9HCF6	0.0	3618	1732	1.000	1.000	TRPM3_HUMAN Transient receptor potential cation channel subfamily M member 3 OS=Homo sapiens OX=9606 GN=TRPM3 PE=1 SV=4
13	G5ECM4	3.50e-176	579	1694	0.182	0.187	G5ECM4_CAEEL GTL-1 OS=Caenorhabditis elegans OX=6239 GN=gtl-1 PE=1 SV=1
14	A0A0R4IMY7	3.69e-159	527	1470	0.229	0.270	TRPM2_DANRE Transient receptor potential cation channel subfamily M member 2 OS=Danio rerio OX=7955 GN=trpm2 PE=1 SV=2
15	G5EE91	3.98e-152	516	1931	0.159	0.142	G5EE91_CAEEL LSDAT_euk domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gon-2 PE=1 SV=1
16	G5EGP7	5.80e-152	516	1971	0.159	0.140	G5EGP7_CAEEL LSDAT_euk domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gon-2 PE=1 SV=1
17	Q93971	9.55e-152	516	2032	0.159	0.135	TRPG_CAEEL Transient receptor potential channel OS=Caenorhabditis elegans OX=6239 GN=gon-2 PE=1 SV=4
18	S5TRY1	1.10e-151	501	1260	0.219	0.301	S5TRY1_DANRE Transient receptor potential cation channel, subfamily M, member 4a OS=Danio rerio OX=7955 GN=TRPM4a PE=2 SV=1
19	E9PTA2	3.24e-149	500	1507	0.226	0.260	TRPM2_RAT Transient receptor potential cation channel subfamily M member 2 OS=Rattus norvegicus OX=10116 GN=Trpm2 PE=1 SV=3
20	Q91YD4	4.93e-148	497	1506	0.208	0.240	TRPM2_MOUSE Transient receptor potential cation channel subfamily M member 2 OS=Mus musculus OX=10090 GN=Trpm2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00520 Ion_trans	1.4e-14	65.5	Ion transport protein
2	PF18139 LSDAT_euk	1.9e-120	412.8	SLOG in TRPM
3	PF18171 LSDAT_prok	1.6e-11	55.3	SLOG in TRPM, prokaryote
4	PF16519 TRPM_tetra	6e-21	85.6	Tetramerisation domain of TRPM

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005581957.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005582573.1	0.843	Belongs to the transient receptor (TC 1.A.4) family.
2	9541.XP_005572828.1	0.815	Uncharacterized protein
3	9541.XP_005581105.1	0.809	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 97% coverage of the annotated genomic feature by RNAseq alignments
4	9541.XP_005582571.1	0.763	Belongs to the transient receptor (TC 1.A.4) family.
5	9541.XP_005583029.1	0.745	Transient receptor potential cation channel subfamily V member 2 isoform X1
6	9541.XP_005545101.1	0.707	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 isoform X1
7	9541.XP_005563579.1	0.705	Ankyrin-like with transmembrane domains protein 1
8	9541.XP_005546057.1	0.697	Uncharacterized protein
9	9541.XP_005541823.1	0.688	Protein S100-A1
10	9541.XP_005561309.1	0.685	Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction
11	9541.XP_005577027.1	0.643	Anoctamin-1 isoform X1
12	9541.XP_005576071.1	0.547	Uncharacterized protein
13	9541.XP_005581936.1	0.540	Belongs to the MAGUK family.
14	9541.XP_005542459.1	0.525	Uncharacterized protein
15	9541.XP_005594455.1	0.506	Short transient receptor potential channel 5 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005262	1.000	calcium channel activity
GO:0005488	0.990	binding
GO:0005515	0.950	protein binding
GO:0022836	0.789	gated channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0006811	0.995	monoatomic ion transport
GO:0006812	0.994	monoatomic cation transport
GO:0030001	0.983	metal ion transport
GO:0055085	0.971	transmembrane transport
GO:0006816	0.934	calcium ion transport
GO:0034220	0.926	monoatomic ion transmembrane transport
GO:0070588	0.916	calcium ion transmembrane transport
GO:0050789	0.801	regulation of biological process
GO:0050794	0.794	regulation of cellular process
GO:0050896	0.746	response to stimulus
GO:0032501	0.506	multicellular organismal process
GO:0042592	0.495	homeostatic process
GO:0065008	0.474	regulation of biological quality
GO:0032879	0.473	regulation of localization
GO:0098771	0.433	inorganic ion homeostasis
GO:0055080	0.433	monoatomic cation homeostasis
GO:0016043	0.420	cellular component organization
GO:0051716	0.367	cellular response to stimulus
GO:0051239	0.349	regulation of multicellular organismal process
GO:0007165	0.315	signal transduction
GO:0003008	0.314	system process
GO:0009628	0.300	response to abiotic stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]