StarFunc result for job id Q9HCG7

User Input

>input (927 residues)
MGTQDPGNMGTGVPASEQISCAKEDPQVYCPEETGGTKDVQVTDCKSPEDSRPPKETDCC
NPEDSGQLMVSYEGKAMGYQVPPFGWRICLAHEFTEKRKPFQANNVSLSNMIKHIGMGLR
YLQWWYRKTHVEKKTPFIDMINSVPLRQIYGCPLGGIGGGTITRGWRGQFCRWQLNPGMY
QHRTVIADQFTVCLRREGQTVYQQVLSLERPSVLRSWNWGLCGYFAFYHALYPRAWTVYQ
LPGQNVTLTCRQITPILPHDYQDSSLPVGVFVWDVENEGDEALDVSIMFSMRNGLGGGDD
APGGLWNEPFCLERSGETVRGLLLHHPTLPNPYTMAVAARVTAATTVTHITAFDPDSTGQ
QVWQDLLQDGQLDSPTGQSTPTQKGVGIAGAVCVSSKLRPRGQCRLEFSLAWDMPRIMFG
AKGQVHYRRYTRFFGQDGDAAPALSHYALCRYAEWEERISAWQSPVLDDRSLPAWYKSAL
FNELYFLADGGTVWLEVLEDSLPEELGRNMCHLRPTLRDYGRFGYLEGQEYRMYNTYDVH
FYASFALIMLWPKLELSLQYDMALATLREDLTRRRYLMSGVMAPVKRRNVIPHDIGDPDD
EPWLRVNAYLIHDTADWKDLNLKFVLQVYRDYYLTGDQNFLKDMWPVCLAVMESEMKFDK
DHDGLIENGGYADQTYDGWVTTGPSAYCGGLWLAAVAVMVQMAALCGAQDIQDKFSSILS
RGQEAYERLLWNGRYYNYDSSSRPQSRSVMSDQCAGQWFLKACGLGEGDTEVFPTQHVVR
ALQTIFELNVQAFAGGAMGAVNGMQPHGVPDKSSVQSDEVWVGVVYGLAATMIQEGLTWE
GFQTAEGCYRTVWERLGLAFQTPEAYCQQRVFRSLAYMRPLSIWAMQLALQQQQHKKASW
PKVKQGTGLRTGPMFGPKEAMANLSPE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7F5W0	0.890	0.969	0.000	851	0.605	0.659	E7F5W0.pdb.gz	E7F5W0_DANRE Non-lysosomal glucosylceramidase OS=Danio rerio OX=7955 GN=gba2 PE=1 SV=3
2	AFDB:Q69ZF3	0.947	0.956	0.000	918	0.866	0.875	Q69ZF3.pdb.gz	GBA2_MOUSE Non-lysosomal glucosylceramidase OS=Mus musculus OX=10090 GN=Gba2 PE=1 SV=2
3	AFDB:Q9HCG7	1.000	1.000	0.000	927	1.000	1.000	Q9HCG7.pdb.gz	GBA2_HUMAN Non-lysosomal glucosylceramidase OS=Homo sapiens OX=9606 GN=GBA2 PE=1 SV=2
4	AFDB:Q8GUI9	0.827	0.802	1.323E-80	957	0.371	0.359	Q8GUI9.pdb.gz	Q8GUI9_ARATH Non-lysosomal glucosylceramidase OS=Arabidopsis thaliana OX=3702 GN=At5g49900 PE=1 SV=1
5	AFDB:F4JLJ2	0.824	0.828	4.285E-80	922	0.361	0.363	F4JLJ2.pdb.gz	F4JLJ2_ARATH Non-lysosomal glucosylceramidase OS=Arabidopsis thaliana OX=3702 GN=GCD3 PE=1 SV=1
6	AFDB:F4HR96	0.817	0.800	1.264E-79	947	0.351	0.343	F4HR96.pdb.gz	F4HR96_ARATH Non-lysosomal glucosylceramidase OS=Arabidopsis thaliana OX=3702 GN=At1g33700 PE=1 SV=1
7	AFDB:Q8VZ08	0.817	0.797	2.445E-78	950	0.386	0.377	Q8VZ08.pdb.gz	Q8VZ08_ARATH Non-lysosomal glucosylceramidase OS=Arabidopsis thaliana OX=3702 GN=At3g24180 PE=1 SV=1
8	AFDB:C8VAK7	0.570	0.748	1.938E-19	688	0.109	0.147	C8VAK7.pdb.gz	C8VAK7_EMENI Glutaminase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04809 PE=4 SV=1
9	PDB:5gw7B	0.436	0.516	9.988E-12	760	0.076	0.092	5gw7B.pdb.gz	Crystal structure of the enzyme-product complex reveals sugar ring distortion during catalysis by family 63 inverting alpha-glycosidase
10	PDB:4j5tA	0.349	0.395	1.002E-9	788	0.093	0.109	4j5tA.pdb.gz
11	PDB:6ttjC	0.301	0.583	1.400E-6	441	0.056	0.118	6ttjC.pdb.gz
12	PDB:2jg0A	0.290	0.505	1.469E-5	507	0.055	0.101	2jg0A.pdb.gz	Molecular Basis for Trehalase Inhibition Revealed by the Structure of Trehalase in Complex with Potent Inhibitors.
13	PDB:7eawA	0.265	0.409	1.540E-5	560	0.065	0.107	7eawA.pdb.gz	pH-dependent alteration of substrate specificity of plant trehalase and its molecular mechanism
14	AFDB:Q8IZP9	0.076	0.071	8.533E-4	1017	0.118	0.107	Q8IZP9.pdb.gz	AGRG2_HUMAN Adhesion G-protein coupled receptor G2 OS=Homo sapiens OX=9606 GN=ADGRG2 PE=1 SV=2
15	PDB:1w6jA	0.225	0.275	1.061E-3	727	0.049	0.062	1w6jA.pdb.gz	Insight Into Steroid Scaffold Formation from the Structure of Human Oxidosqualene Cyclase
16	PDB:6al2A	0.159	0.278	1.165E-3	484	0.033	0.064	6al2A.pdb.gz
17	PDB:3qryB	0.283	0.544	1.474E-3	426	0.052	0.113	3qryB.pdb.gz	Analysis of a New Family of Widely Distributed Metal-independent {alpha}-Mannosidases Provides Unique Insight into the Processing of N-Linked Glycans.
18	AFDB:Q8CJ11	0.080	0.075	2.765E-3	1013	0.119	0.109	Q8CJ11.pdb.gz	AGRG2_RAT Adhesion G-protein coupled receptor G2 OS=Rattus norvegicus OX=10116 GN=Adgrg2 PE=1 SV=1
19	PDB:6frvA	0.256	0.466	2.985E-3	467	0.054	0.107	6frvA.pdb.gz	Structural insight into industrially relevant glucoamylases: flexible positions of starch-binding domains.
20	PDB:6fopA	0.160	0.196	3.279E-3	717	0.096	0.124	6fopA.pdb.gz	Novel insights into the degradation of beta-1,3-glucans by the cellulosome of Clostridium thermocellum revealed by structure and function studies of a family 81 glycoside hydrolase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F5W0	0.0	1198	851	0.603	0.657	E7F5W0_DANRE Non-lysosomal glucosylceramidase OS=Danio rerio OX=7955 GN=gba2 PE=1 SV=3
2	F4HR96	0.0	565	947	0.365	0.357	F4HR96_ARATH Non-lysosomal glucosylceramidase OS=Arabidopsis thaliana OX=3702 GN=At1g33700 PE=1 SV=1
3	F4JLJ2	0.0	584	922	0.359	0.361	F4JLJ2_ARATH Non-lysosomal glucosylceramidase OS=Arabidopsis thaliana OX=3702 GN=GCD3 PE=1 SV=1
4	Q69ZF3	0.0	1618	918	0.867	0.876	GBA2_MOUSE Non-lysosomal glucosylceramidase OS=Mus musculus OX=10090 GN=Gba2 PE=1 SV=2
5	Q8GUI9	0.0	613	957	0.370	0.358	Q8GUI9_ARATH Non-lysosomal glucosylceramidase OS=Arabidopsis thaliana OX=3702 GN=At5g49900 PE=1 SV=1
6	Q8VZ08	0.0	600	950	0.397	0.387	Q8VZ08_ARATH Non-lysosomal glucosylceramidase OS=Arabidopsis thaliana OX=3702 GN=At3g24180 PE=1 SV=1
7	Q9HCG7	0.0	1934	927	1.000	1.000	GBA2_HUMAN Non-lysosomal glucosylceramidase OS=Homo sapiens OX=9606 GN=GBA2 PE=1 SV=2
8	Q9JJS6	1.0	35.4	566	0.024	0.039	BCDO1_MOUSE Beta,beta-carotene 15,15'-dioxygenase OS=Mus musculus OX=10090 GN=Bco1 PE=1 SV=2
9	Q91XT5	1.9	34.7	566	0.024	0.039	BCDO1_RAT Beta,beta-carotene 15,15'-dioxygenase OS=Rattus norvegicus OX=10116 GN=Bco1 PE=2 SV=1
10	Q6PCN7	2.7	34.3	1003	0.027	0.025	HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus OX=10090 GN=Hltf PE=1 SV=1
11	Q9STX5	3.4	33.9	823	0.042	0.047	ENPL_ARATH Endoplasmin homolog OS=Arabidopsis thaliana OX=3702 GN=HSP90-7 PE=1 SV=1
12	Q9HAY6	5.8	33.1	547	0.022	0.037	BCDO1_HUMAN Beta,beta-carotene 15,15'-dioxygenase OS=Homo sapiens OX=9606 GN=BCO1 PE=1 SV=1
13	Q56775	6.1	32.7	349	0.017	0.046	GUMI_XANCE GDP-mannose:glycolipid 4-beta-D-mannosyltransferase OS=Xanthomonas campestris pv. campestris OX=340 GN=gumI PE=1 SV=2
14	Q9NR48	6.8	33.1	2969	0.022	0.007	ASH1L_HUMAN Histone-lysine N-methyltransferase ASH1L OS=Homo sapiens OX=9606 GN=ASH1L PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17389 Bac_rhamnosid6H	19	16.0	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain
2	PF17168 DUF5127	1.5e+02	13.6	Domain of unknown function (DUF5127)
3	PF04685 DUF608	1e-165	562.9	Glycosyl-hydrolase family 116, catalytic region
4	PF12215 Glyco_hydr_116N	4.9e-99	343.3	beta-glucosidase 2, glycosyl-hydrolase family 116 N-term

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000367343

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378897	0.970	Neutral ceramidase
2	9606.ENSP00000371152	0.963	Acid ceramidase
3	9606.ENSP00000314508	0.956	Glucosylceramidase that catalyzes, within the lysosomal compartment, the hydrolysis of glucosylceramide/GlcCer into free ceramide and glucose . Thereby, plays a central role in the degradation of complex lipids and the turnover of cellular membranes . Through the production of ceramides, participates to the PKC-activated salvage pathway of ceramide formation . Also plays a role in cholesterol metabolism . May either catalyze the glucosylation of cholesterol, through a transglucosylation reaction that transfers glucose from glucosylceramide to cholesterol . The short chain saturated C8: [...]
4	9606.ENSP00000306459	0.954	Beta-1,4-galactosyltransferase 6
5	9606.ENSP00000378176	0.947	Phosphatidylcholine:ceramide cholinephosphotransferase 2
6	9606.ENSP00000301452	0.946	Alkaline ceramidase 1
7	9606.ENSP00000216264	0.943	Ceramide kinase
8	9606.ENSP00000261304	0.941	Galactocerebrosidase
9	9606.ENSP00000342609	0.939	Alkaline ceramidase 2
10	9606.ENSP00000271688	0.934	Ceramide synthase 2
11	9606.ENSP00000363397	0.933	Ceramide glucosyltransferase
12	9606.ENSP00000376453	0.932	Ceramide synthase 6
13	9606.ENSP00000307126	0.930	Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2
14	9606.ENSP00000316476	0.930	Sphingolipid delta(4)-desaturase DES1
15	9606.ENSP00000306920	0.926	Beta-galactosidase
16	9606.ENSP00000284382	0.923	Ceramide synthase 3
17	9606.ENSP00000419194	0.923	Microseminoprotein, prostate associated
18	9606.ENSP00000251363	0.922	Ceramide synthase 4
19	9606.ENSP00000325485	0.921	Ceramide synthase 5
20	9606.ENSP00000354829	0.916	Phosphatidylcholine:ceramide cholinephosphotransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004348	1.000	glucosylceramidase activity
GO:0008422	1.000	beta-glucosidase activity
GO:0016740	0.731	transferase activity
GO:0046527	0.707	glucosyltransferase activity
GO:0005488	0.684	binding
GO:0005515	0.540	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0006672	0.992	ceramide metabolic process
GO:1901135	0.991	carbohydrate derivative metabolic process
GO:0046466	0.990	membrane lipid catabolic process
GO:0006687	0.947	glycosphingolipid metabolic process
GO:1901615	0.792	organic hydroxy compound metabolic process
GO:0030149	0.791	sphingolipid catabolic process
GO:0044281	0.728	small molecule metabolic process
GO:1901136	0.677	carbohydrate derivative catabolic process
GO:0065007	0.382	biological regulation
GO:0032502	0.379	developmental process
GO:0048856	0.362	anatomical structure development
GO:0032501	0.344	multicellular organismal process
GO:0071840	0.325	cellular component organization or biogenesis
GO:0007275	0.316	multicellular organism development
GO:0016043	0.312	cellular component organization
GO:1901360	0.310	organic cyclic compound metabolic process
GO:0050789	0.300	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005783	0.998	endoplasmic reticulum
GO:0071944	0.995	cell periphery
GO:0005886	0.992	plasma membrane
GO:0005829	0.951	cytosol
GO:0031090	0.913	organelle membrane
GO:0031984	0.816	organelle subcompartment
GO:0098827	0.623	endoplasmic reticulum subcompartment
GO:0005789	0.591	endoplasmic reticulum membrane
GO:0005794	0.447	Golgi apparatus
GO:0043233	0.339	organelle lumen
GO:0098588	0.322	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13269	1.000	a beta-D-glucosyl-(1<->1')-N-acylsphing-4-enine + H2O = an N-acylsphing-4-enine + D-glucose
EC:3.2.1.45	1.000	glucosylceramidase.
EC:3.2.1.21	1.000	beta-glucosidase.
EC:2.-.-.-	0.731	Transferases.
EC:2.4.1.-	0.707	Hexosyltransferases.

[back to server]