StarFunc result for job id Q9HCH0

User Input

>input (1334 residues)
MSEAMDQPAGGPGNPRPGEGDDGSMEPGTCQELLHRLRELEAENSALAQANENQRETYER
CLDEVANHVVQALLNQKDLREECIKLKKRVFDLERQNQMLSALFQQKLQLTTGSLPQIPL
TPLQPPSEPPASPSLSSTEGPAAPLPLGHCAGQREVCWEQQLRPGGPGPPAAPPPALDAL
SPFLRKKAQILEVLRALEETDPLLLCSPATPWRPPGQGPGSPEPINGELCGPPQPEPSPW
APCLLLGPGNLGGLLHWERLLGGLGGEEDTGRPWGPSRGPPQAQGTSSGPNCAPGSSSSS
SSDEAGDPNEAPSPDTLLGALARRQLNLGQLLEDTESYLQAFLAGAAGPLNGDHPGPGQS
SSPDQAPPQLSKSKGLPKSAWGGGTPEAHRPGFGATSEGQGPLPFLSMFMGAGDAPLGSR
PGHPHSSSQVKSKLQIGPPSPGEAQGPLLPSPARGLKFLKLPPTSEKSPSPGGPQLSPQL
PRNSRIPCRNSGSDGSPSPLLARRGLGGGELSPEGAQGLPTSPSPCYTTPDSTQLRPPQS
ALSTTLSPGPVVSPCYENILDLSRSTFRGPSPEPPPSPLQVPTYPQLTLEVPQAPEVLRS
PGVPPSPCLPESYPYGSPQEKSLDKAGSESPHPGRRTPGNSSKKPSQGSGRRPGDPGSTP
LRDRLAALGKLKTGPEGALGSEKNGVPARPGTEKTRGPGKSGESAGDMVPSIHRPLEQLE
AKGGIRGAVALGTNSLKQQEPGLMGDPGARVYSSHSMGARVDLEPVSPRSCLTKVELAKS
RLAGALCPQVPRTPAKVPTSAPSLGKPNKSPHSSPTKLPSKSPTKVVPRPGAPLVTKESP
KPDKGKGPPWADCGSTTAQSTPLVPGPTDPSQGPEGLAPHSAIEEKVMKGIEENVLRLQG
QERAPGAEVKHRNTSSIASWFGLKKSKLPALNRRTEATKNKEGAGGGSPLRREVKMEARK
LEAESLNISKLMAKAEDLRRALEEEKAYLSSRARPRPGGPAPGPNTGLGQVQGQLAGMYQ
GADTFMQQLLNRVDGKELPSKSWREPKPEYGDFQPVSSDPKSPWPACGPRNGLVGPLQGC
GKPPGKPSSEPGRREETPSEDSLAEPVPTSHFTACGSLTRTLDSGIGTFPPPDHGSSGTP
SKNLPKTKPPRLDPPPGVPPARPPPLTKVPRRAHTLEREVPGIEELLVSGRHPSMPAFPA
LLPAAPGHRGHETCPDDPCEDPGPTPPVQLAKNWTFPNTRAAGSSSDPLMCPPRQLEGLP
RTPMALPVDRKRSQEPSRPSPTPQGPPFGGSRTPSTSDMAEEGRVASGGPPGLETSESLS
DSLYDSLSSCGSQG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HCH0	0.999	0.999	0.000	1334	1.000	1.000	Q9HCH0.pdb.gz	NCK5L_HUMAN Nck-associated protein 5-like OS=Homo sapiens OX=9606 GN=NCKAP5L PE=1 SV=4
2	AFDB:Q7TSY8	0.060	0.068	1.232E-5	1164	0.132	0.151	Q7TSY8.pdb.gz	SGO2_MOUSE Shugoshin 2 OS=Mus musculus OX=10090 GN=Sgo2 PE=1 SV=1
3	AFDB:Q96T23	0.037	0.035	1.526E-5	1441	0.127	0.117	Q96T23.pdb.gz	RSF1_HUMAN Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1 PE=1 SV=2
4	AFDB:E1JJ76	0.038	0.043	3.339E-5	1165	0.116	0.133	E1JJ76.pdb.gz	E1JJ76_DROME Alhambra, isoform H OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
5	AFDB:Q60988	0.042	0.043	5.120E-5	1262	0.113	0.120	Q60988.pdb.gz	STIL_MOUSE SCL-interrupting locus protein homolog OS=Mus musculus OX=10090 GN=Stil PE=1 SV=1
6	AFDB:Q70HU3	0.030	0.034	8.428E-5	1135	0.116	0.137	Q70HU3.pdb.gz	Q70HU3_DROME PNUTSDm protein OS=Drosophila melanogaster OX=7227 GN=PNUTS PE=2 SV=1
7	AFDB:Q8JGS1	0.037	0.039	2.634E-4	1263	0.118	0.124	Q8JGS1.pdb.gz	STIL_DANRE SCL-interrupting locus protein homolog OS=Danio rerio OX=7955 GN=stil PE=1 SV=2
8	AFDB:Q380Z7	0.030	0.023	5.000E-4	2059	0.150	0.097	Q380Z7.pdb.gz	Q380Z7_TRYB2 Flagellar Member 7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8650 PE=4 SV=1
9	AFDB:A8JNK1	0.067	0.071	7.138E-4	1241	0.142	0.153	A8JNK1.pdb.gz	A8JNK1_DROME Ensconsin, isoform F OS=Drosophila melanogaster OX=7227 GN=ens PE=1 SV=1
10	AFDB:Q15468	0.041	0.041	1.019E-3	1287	0.117	0.121	Q15468.pdb.gz	STIL_HUMAN SCL-interrupting locus protein OS=Homo sapiens OX=9606 GN=STIL PE=1 SV=2
11	PDB:7mq8SB	0.019	0.053	5.982	440	0.008	0.025	7mq8SB.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:6n8jb	0.029	0.050	6.423	647	0.022	0.045	6n8jb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
13	PDB:5j0nF	0.021	0.062	6.897	356	0.006	0.022	5j0nF.pdb.gz	Structure of a Holliday junction complex reveals mechanisms governing a highly regulated DNA transaction.
14	PDB:6id0L	0.035	0.072	7.953	475	0.017	0.048	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
15	PDB:7kzfF	0.020	0.042	7.953	483	0.007	0.019	7kzfF.pdb.gz
16	PDB:7a6hQ	0.030	0.253	8.540	104	0.006	0.077	7a6hQ.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
17	PDB:2mxxA	0.016	0.095	9.170	179	0.010	0.078	2mxxA.pdb.gz
18	PDB:2l9qA	0.019	0.195	9.847	109	0.011	0.138	2l9qA.pdb.gz
19	PDB:4v6wCE	0.021	0.080	9.847	228	0.009	0.053	4v6wCE.pdb.gz	Structures of the human and Drosophila 80S ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HCH0	0.0	2593	1334	0.999	0.999	NCK5L_HUMAN Nck-associated protein 5-like OS=Homo sapiens OX=9606 GN=NCKAP5L PE=1 SV=4
2	A1Z951	1.43e-05	52.0	639	0.022	0.045	A1Z951_DROME MIP12871p OS=Drosophila melanogaster OX=7227 GN=CG12488 PE=2 SV=2
3	A0A0B4KFS6	1.78e-05	51.6	661	0.022	0.044	A0A0B4KFS6_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=CG12488 PE=4 SV=1
4	F0JAQ8	1.83e-05	51.6	662	0.022	0.044	F0JAQ8_DROME MIP12971p OS=Drosophila melanogaster OX=7227 GN=CG42663-RB PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15246 NCKAP5	7.4e-73	257.4	Nck-associated protein 5, Peripheral clock protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337998

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382507	0.776	UBX domain-containing protein 2B
2	9606.ENSP00000258991	0.754	Testis-expressed protein 2
3	9606.ENSP00000294129	0.737	NCK-interacting protein with SH3 domain
4	9606.ENSP00000483486	0.736	ADP-ribosylation factor-related protein 1
5	9606.ENSP00000315664	0.720	Zinc finger protein 18
6	9606.ENSP00000346265	0.698	Synaptotagmin-5
7	9606.ENSP00000293662	0.691	General receptor for phosphoinositides 1-associated scaffold protein
8	9606.ENSP00000340596	0.685	Ubiquitin-protein ligase E3B
9	9606.ENSP00000350223	0.617	DnaJ homolog subfamily C member 14
10	9606.ENSP00000441158	0.603	Clathrin heavy chain 2
11	9606.ENSP00000302202	0.601	Uncharacterized protein C2orf15
12	9606.ENSP00000228515	0.594	Cysteine/serine-rich nuclear protein 2
13	9606.ENSP00000352513	0.587	Myelin protein zero-like protein 1
14	9606.ENSP00000401878	0.587	Kelch repeat and BTB domain-containing protein 8
15	9606.ENSP00000312262	0.585	Beta-adrenergic receptor kinase 1
16	9606.ENSP00000216465	0.572	Maleylacetoacetate isomerase
17	9606.ENSP00000462116	0.559	SAP30-binding protein
18	9606.ENSP00000432799	0.555	Mesencephalic astrocyte-derived neurotrophic factor
19	9606.ENSP00000257894	0.547	Protein FAM186B
20	9606.ENSP00000323302	0.540	POC1 centriolar protein homolog B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0006996	0.916	organelle organization
GO:0000226	0.909	microtubule cytoskeleton organization
GO:0001578	0.724	microtubule bundle formation
GO:0051261	0.688	protein depolymerization
GO:0031109	0.688	microtubule polymerization or depolymerization
GO:0007019	0.682	microtubule depolymerization
GO:0065007	0.665	biological regulation
GO:0050789	0.499	regulation of biological process
GO:0050794	0.487	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0035371	0.998	microtubule plus-end
GO:0005813	0.996	centrosome
GO:0043227	0.930	membrane-bounded organelle
GO:0043231	0.843	intracellular membrane-bounded organelle
GO:0005737	0.824	cytoplasm
GO:0016020	0.477	membrane
GO:0005634	0.387	nucleus
GO:0031981	0.341	nuclear lumen
GO:0005654	0.317	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]