StarFunc result for job id Q9HCJ5

User Input

>input (1215 residues)
MAERGQQPPPAKRLCCRPGGGGGGGGSSGGGGGAGGGYSSACRPGPRAGGAAAAAACGGG
AALGLLPPGKTQSPESLLDIAARRVAEKWPFQRVEERFERIPEPVQRRIVYWSFPRSERE
ICMYSSFNTGGGAAGGPGDDSGGGGGAGGGGGGGSSSSPAATSAAATSAAAAAAAAAAAA
AAAAGAGAPSVGAAGAADGGDETRLPFRRGIALLESGCVDNVLQVGFHLSGTVTEPAIQS
EPETVCNVAISFDRCKITSVTCSCGNKDIFYCAHVVALSLYRIRKPDQVKLHLPISETLF
QMNRDQLQKFVQYLITVHHTEVLPTAQKLADEILSQNSEINQVHGAPDPTAGASIDDENC
WHLDEEQVQEQVKLFLSQGGYHGSGKQLNLLFAKVREMLKMRDSNGARMLTLITEQFMAD
PRLSLWRQQGTAMTDKYRQLWDELGALWMCIVLNPHCKLEQKASWLKQLKKWNSVDVCPW
EDGNHGSELPNLTNALPQGANANQDSSNRPHRTVFTRAIEACDLHWQDSHLQHIISSDLY
TNYCYHDDTENSLFDSRGWPLWHEHVPTACARVDALRSHGYPREALRLAIAIVNTLRRQQ
QKQLEMFRTQKKELPHKNITSITNLEGWVGHPLDPVGTLFSSLMEACRIDDENLSGFSDF
TENMGQCKSLEYQHLPAHKFLEEGESYLTLAVEVALIGLGQQRIMPDGLYTQEKVCRNEE
QLISKLQEIELDDTLVKIFRKQAVFLLEAGPYSGLGEIIHRESVPMHTFAKYLFTSLLPH
DAELAYKIALRAMRLLVLESTAPSGDLTRPHHIASVVPNRYPRWFTLSHIESQQCELAST
MLTAAKGDVRRLETVLESIQKNIHSSSHIFKLAQDAFKIATLMDSLPDITLLKVSLELGL
QVMRMTLSTLNWRRREMVRWLVTCATEVGVYALDSIMQTWFTLFTPTEATSIVATTVMSN
STIVRLHLDCHQQEKLASSARTLALQCAMKDPQNCALSALTLCEKDHIAFETAYQIVLDA
ATTGMSYTQLFTIARYMEHRGYPMRAYKLATLAMTHLNLSYNQDTHPAINDVLWACALSH
SLGKNELAAIIPLVVKSVKCATVLSDILRRCTLTTPGMVGLHGRRNSGKLMSLDKAPLRQ
LLDATIGAYINTTHSRLTHISPRHYSEFIEFLSKARETFLMAHDGHIQFTQFIDNLKQIY
KGKKKLMMLVRERFG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80TB7	0.913	0.919	0.000	1207	0.963	0.969	Q80TB7.pdb.gz	ZSWM6_MOUSE Zinc finger SWIM domain-containing protein 6 OS=Mus musculus OX=10090 GN=Zswim6 PE=1 SV=3
2	AFDB:Q9P217	0.881	0.903	0.000	1185	0.711	0.729	Q9P217.pdb.gz	ZSWM5_HUMAN Zinc finger SWIM domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ZSWIM5 PE=2 SV=2
3	AFDB:A7E2V4	0.420	0.297	3.639E-29	1837	0.248	0.164	A7E2V4.pdb.gz	ZSWM8_HUMAN Zinc finger SWIM domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZSWIM8 PE=1 SV=1
4	AFDB:Q9VWN9	0.487	0.313	1.340E-27	2103	0.256	0.148	Q9VWN9.pdb.gz	ZSWM8_DROME Zinc finger SWIM domain-containing protein 8 homolog OS=Drosophila melanogaster OX=7227 GN=Dora PE=2 SV=2
5	PDB:7dkhI	0.094	0.116	3.365E-5	914	0.074	0.098	7dkhI.pdb.gz
6	PDB:4bujB	0.100	0.093	2.161E-4	1367	0.094	0.083	4bujB.pdb.gz
7	AFDB:A3KDM3	0.118	0.121	2.617E-4	1160	0.079	0.083	A3KDM3.pdb.gz	A3KDM3_DANRE CTR9 homolog, Paf1/RNA polymerase II complex component OS=Danio rerio OX=7955 GN=fc54a06 PE=1 SV=1
8	PDB:7mq8LP	0.152	0.280	3.281E-4	567	0.050	0.108	7mq8LP.pdb.gz	Nucleolar maturation of the human small subunit processome.
9	PDB:6tedQ	0.087	0.104	3.818E-4	890	0.087	0.119	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
10	PDB:4c0qA	0.109	0.142	7.854E-4	871	0.085	0.118	4c0qA.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
11	PDB:7qe7Y	0.089	0.176	7.854E-4	502	0.054	0.131	7qe7Y.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
12	PDB:7u6fD1	0.145	0.193	7.854E-4	733	0.065	0.108	7u6fD1.pdb.gz
13	AFDB:Q62018	0.113	0.114	8.488E-4	1173	0.072	0.074	Q62018.pdb.gz	CTR9_MOUSE RNA polymerase-associated protein CTR9 homolog OS=Mus musculus OX=10090 GN=Ctr9 PE=1 SV=2
14	PDB:7t3pA	0.105	0.070	9.141E-4	2066	0.087	0.051	7t3pA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
15	PDB:7qdrB	0.111	0.111	1.064E-3	1212	0.096	0.097	7qdrB.pdb.gz
16	PDB:6bq1B	0.101	0.147	1.148E-3	728	0.081	0.136	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
17	AFDB:O60184	0.106	0.115	2.192E-3	1102	0.038	0.042	O60184.pdb.gz	CYC8_SCHPO General transcriptional corepressor ssn6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssn6 PE=1 SV=1
18	AFDB:B8JID6	0.150	0.110	4.683E-3	1867	0.067	0.044	B8JID6.pdb.gz
19	AFDB:P11075	0.145	0.101	5.248E-3	2009	0.092	0.056	P11075.pdb.gz	SEC7_YEAST Protein transport protein SEC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC7 PE=1 SV=2
20	AFDB:Q9VW83	0.121	0.094	5.662E-3	1847	0.077	0.051	Q9VW83.pdb.gz	Q9VW83_DROME Gigas, isoform A OS=Drosophila melanogaster OX=7227 GN=gig PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80TB7	0.0	2434	1207	0.965	0.972	ZSWM6_MOUSE Zinc finger SWIM domain-containing protein 6 OS=Mus musculus OX=10090 GN=Zswim6 PE=1 SV=3
2	Q8C7B8	0.0	1288	1101	0.529	0.584	ZSWM4_MOUSE Zinc finger SWIM domain-containing protein 4 OS=Mus musculus OX=10090 GN=Zswim4 PE=1 SV=2
3	Q3UHH1	6.09e-48	190	1832	0.101	0.067	ZSWM8_MOUSE Zinc finger SWIM domain-containing protein 8 OS=Mus musculus OX=10090 GN=Zswim8 PE=1 SV=1
4	A7E2V4	6.48e-48	190	1837	0.101	0.067	ZSWM8_HUMAN Zinc finger SWIM domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZSWIM8 PE=1 SV=1
5	Q9VWN9	1.47e-45	182	2103	0.101	0.058	ZSWM8_DROME Zinc finger SWIM domain-containing protein 8 homolog OS=Drosophila melanogaster OX=7227 GN=Dora PE=2 SV=2
6	Q21875	1.64e-23	110	1717	0.071	0.050	Q21875_CAEEL SWIM-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ebax-1 PE=1 SV=2
7	Q9P217	2.54e-19	97.1	1185	0.053	0.054	ZSWM5_HUMAN Zinc finger SWIM domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ZSWIM5 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04434 SWIM	8.4e+02	11.1	SWIM zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000252744

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260983	0.713	E3 ubiquitin-protein ligase HECW2
2	9606.ENSP00000381693	0.696	Zinc finger SWIM-type containing 8
3	9606.ENSP00000262306	0.685	Elongin-B
4	9606.ENSP00000444856	0.666	Cullin-2
5	9606.ENSP00000291900	0.637	Protein zer-1 homolog
6	9606.ENSP00000442129	0.611	Hepatoma-derived growth factor-like protein 1
7	9606.ENSP00000359385	0.608	Glomulin
8	9606.ENSP00000294353	0.598	Protein zyg-11 homolog B
9	9606.ENSP00000360583	0.593	Protein zyg-11 homolog A
10	9606.ENSP00000216225	0.551	E3 ubiquitin-protein ligase RBX1
11	9606.ENSP00000254323	0.545	Zinc finger SWIM-type containing 4
12	9606.ENSP00000352614	0.545	Zinc finger SWIM-type containing 5
13	9606.ENSP00000308236	0.540	COMM domain-containing protein 1
14	9606.ENSP00000321388	0.540	Ankyrin repeat and SOCS box protein 4
15	9606.ENSP00000341684	0.527	Coiled-coil domain containing 15
16	9606.ENSP00000368982	0.517	Katanin p80 WD40 repeat-containing subunit B1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.554	catalytic activity
GO:0030674	0.400	protein-macromolecule adaptor activity
GO:0140767	0.366	enzyme-substrate adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009987	0.993	cellular process
GO:0032502	0.965	developmental process
GO:0007275	0.962	multicellular organism development
GO:0071840	0.919	cellular component organization or biogenesis
GO:0016043	0.914	cellular component organization
GO:0048731	0.908	system development
GO:0048513	0.902	animal organ development
GO:0030154	0.892	cell differentiation
GO:0007399	0.888	nervous system development
GO:0007420	0.868	brain development
GO:0030900	0.862	forebrain development
GO:0048699	0.844	generation of neurons
GO:0040012	0.793	regulation of locomotion
GO:0030334	0.783	regulation of cell migration
GO:0030182	0.757	neuron differentiation
GO:0048666	0.733	neuron development
GO:0021953	0.729	central nervous system neuron differentiation
GO:0021537	0.702	telencephalon development
GO:0030030	0.700	cell projection organization
GO:0009653	0.691	anatomical structure morphogenesis
GO:2001222	0.679	regulation of neuron migration
GO:0120036	0.675	plasma membrane bounded cell projection organization
GO:0031175	0.667	neuron projection development
GO:0021872	0.643	forebrain generation of neurons
GO:0032989	0.577	cellular component morphogenesis
GO:0032990	0.501	cell part morphogenesis
GO:0021879	0.484	forebrain neuron differentiation
GO:0048518	0.355	positive regulation of biological process
GO:0019222	0.353	regulation of metabolic process
GO:0000902	0.351	cell morphogenesis
GO:0048812	0.332	neuron projection morphogenesis
GO:0048522	0.327	positive regulation of cellular process
GO:0031323	0.327	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0098862	0.991	cluster of actin-based cell projections
GO:0032421	0.977	stereocilium bundle
GO:0120025	0.975	plasma membrane bounded cell projection
GO:0043005	0.966	neuron projection
GO:0032420	0.959	stereocilium
GO:0005622	0.824	intracellular anatomical structure
GO:0043229	0.811	intracellular organelle
GO:0005737	0.750	cytoplasm
GO:0032991	0.727	protein-containing complex
GO:0043231	0.725	intracellular membrane-bounded organelle
GO:0005576	0.313	extracellular region
GO:0043232	0.300	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]