StarFunc result for job id Q9HCK1

User Input

>input (2354 residues)
MQKRQGYCSYCRVQYNNLEQHLFSAQHRSLTRQSRRQICTSSLMERFLQDVLQHHPYHCQ
ESSSTQDETHVNTGSSSEVVHLDDAFSEEEEEDEDKVEDEDATEERPSEVSEPIEELHSR
PHKSQEGTQEVSVRPSVIQKLEKGQQQPLEFVHKIGASVRKCNLVDIGQATNNRSNLVRP
PVICNAPASCLPESSNDRPVTANTTSLPPAAHLDSVSKCDPNKVEKYLEQPDGASRNPVP
SSHVETTSFSYQKHKESNRKSLRMNSDKLVLWKDVKSQGKTLSAGLKFHERMGTKGSLRV
KSPSKLAVNPNKTDMPSNKGIFEDTIAKNHEEFFSNMDCTQEEKHLVFNKTAFWEQKCSV
SSEMKFDCISLQSASDQPQETAQDLSLWKEEQIDQEDNYESRGSEMSFDCSSSFHSLTDQ
SKVSAKEVNLSKEVRTDVQYKNNKSYVSKISSDCDDILHLVTNQSQMIVKEISLQNARHI
SLVDQSYESSSSETNFDCDASPQSTSDYPQQSVTEVNLPKEVHIGLVDKNYGSSSSEVSA
DSVFPLQSVVDRPPVAVTETKLRKKAHTSLVDNYGSSCSETSFDCDVSLESVVDHPQLTV
KGRNLKGRQVHLKHKKRKPSSAKAHLDCDVSLGTVADESQRAVEKINLLKEKNADLMDMN
CESHGPEMGFQADAQLADQSQVAEIERQKVDVDLENKSVQSSRSSLSSDSPASLYHSAHD
EPQEALDEVNLKELNIDMEVRSYDCSSSELTFDSDPPLLSVTEQSHLDAEGKERHIDLED
ESCESDSSEITFDSDIPLYSVIDQPEVAVYEEETVDLESKSNESCVSEITFDSDIPLHSG
NDHPEVAVKEVIQKEEYIHLERKNDEPSGSEISSDSHAPLHSVTNSPEVAVKKLNPQKEE
QVHLENKENEPIDSEVSLDYNIIFHSVTGRSEDPIKEISLHTKEHMYLENKSVFETSLDS
DVPLQAATHKPEVIVKETWLQREKHAEFQGRSTEFSGSKTSLDSGVPHYSVTEPQVAVNK
INRKKQYVLENKNDKCSGSEIILDSNVPPQSMTDQPQLAFLKEKHVNLKDKNSKSGDSKI
TFDSEQLQEAVKKIDQWKEEVIGLKNKINEPSTYKLIHHPDVSVQSVADQPKVAIKHVNL
GNENHMYLEVKNSQYSCSEMNLDSGFLGQSIVNRPQITILEQEHIELEGKHNQCCGSEVS
FDSDDPLQSVADRLRETVKEISLWKDEEVDTEDRRNEAKGFEIMYDSDVLQPVAGQPEEV
VKEVSLWKEHVDLENKIVKPTDSRINFDSHEPLQSVTNKIPGANKEINLLREEHVCLDDK
GYVPSDSEIIYVSNIPLQSVIKQPHILEEEHASLEDKSSNSYSPEESSDSNDSFQAAADE
LQKPVKEINLWKEDHIYLEDKSYKLGDFDVSYASHIPVQFVTDQSSVPVKEINLQKKDHN
DLENKNCEVCGSEIKCHSCVHLQSEVDQPQVSYKEADLQKEEHVVMEEKTDQPSDSEMMY
DSDVPFQIVVNQFPGSVKETHLPKVVLVDLVPGDSDYEVISDDIPLQLVTDPPQLTVKDI
SCINTECIDIEDKSCDFFGSEVRCNCKASTPSMTNQCKETFKIINRKKDYIILGEPSCQS
CGSEMNFNVDASDQSMTYESQGPDEKMVKYIDSEDKSCGYNGSKGKFNLEDTSHRTTHRL
QKAHKEASLRKDPRNAGLKGKSCQSSASAVDFGASSKSALHRRADKKKRSKLKHRDLEVS
CEPDGFEMNFQCAPPLPSDTDQPQETVKKRHPCKKVSSDLKEKNHDSQSSSVLKVDSVRN
LKKAKDVIEDNPDEPVLEALPHVPPSFVGKTWSQIMREDDIKINALVKEFREGRFHCYFD
DDCETKKVSSKGKKKVTWADLQGKEDTAPTQAVSESDDIVCGISDIDDLSVALDKPCHRH
PPAERPPKQKGRVASQCQTAKISHSTQTSCKNYPVMKRKIIRQEEDPPKSKCSRLQDDRK
TKKKVKIGTVEFPASCTKVLKPMQPKALVCVLSSLNIKLKEGEGLPFPKMRHHSWDNDIR
FICKYKRNIFDYYEPLIKQIVISPPLSVIVPEFERRNWVKIHFNRSNQNSSAGDNDADGQ
GSASAPLMAVPARYGFNSHQGTSDSSLFLEESKVLHARELPKKRNFQLTFLNHDVVKISP
KSVRNKLLESQSKKKIHGKRVTTSSNKLGFPKKVYKPIILQQKPRKASEKQSIWIRTKPS
DIIRKYISKYSVFLRHRYQSRSAFLGRYLKKKKSVVSRLKKAKRTAKVLLNSSVPPAGAE
ELSSAMANPPPKRPVRASCRVARRRKKTDESYHGRQKGPSTPVRAYDLRSSSCLQQRERM
MTRLANKLRGNEVK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5SS00	0.029	0.028	1.457E-70	2493	0.419	0.396	Q5SS00.pdb.gz	ZDBF2_MOUSE DBF4-type zinc finger-containing protein 2 homolog OS=Mus musculus OX=10090 GN=Zdbf2 PE=2 SV=1
2	AFDB:O88466	0.024	0.026	9.270E-4	1888	0.097	0.121	O88466.pdb.gz	ZN106_MOUSE Zinc finger protein 106 OS=Mus musculus OX=10090 GN=Znf106 PE=1 SV=3
3	AFDB:X2JEM2	0.024	0.024	1.210E-3	2326	0.110	0.111	X2JEM2.pdb.gz	X2JEM2_DROME Secretory 16, isoform I OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
4	AFDB:Q9H4A3	0.031	0.030	1.729E-2	2382	0.111	0.110	Q9H4A3.pdb.gz	WNK1_HUMAN Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1 PE=1 SV=2
5	AFDB:C4XZ24	0.024	0.026	2.577E-2	2164	0.106	0.116	C4XZ24.pdb.gz	FLO11_CLAL4 Flocculation protein FLO11 OS=Clavispora lusitaniae (strain ATCC 42720) OX=306902 GN=FLO11 PE=3 SV=1
6	AFDB:Q9HCM3	0.028	0.033	2.944E-2	1950	0.108	0.130	Q9HCM3.pdb.gz	K1549_HUMAN UPF0606 protein KIAA1549 OS=Homo sapiens OX=9606 GN=KIAA1549 PE=1 SV=4
7	AFDB:Q9VED3	0.022	0.038	3.594E-2	1186	0.062	0.122	Q9VED3.pdb.gz	Q9VED3_DROME Stripe, isoform A OS=Drosophila melanogaster OX=7227 GN=sr PE=4 SV=1
8	AFDB:Q9H2Y7	0.027	0.032	5.012E-2	1883	0.096	0.119	Q9H2Y7.pdb.gz	ZN106_HUMAN Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1
9	AFDB:Q8NFD5	0.030	0.031	5.725E-2	2236	0.110	0.116	Q8NFD5.pdb.gz	ARI1B_HUMAN AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B PE=1 SV=3
10	AFDB:Q9Y2F5	0.027	0.027	5.725E-2	2266	0.126	0.131	Q9Y2F5.pdb.gz	ICE1_HUMAN Little elongation complex subunit 1 OS=Homo sapiens OX=9606 GN=ICE1 PE=1 SV=5
11	PDB:7pt6I	0.018	0.113	5.774E-2	341	0.008	0.053	7pt6I.pdb.gz	The structural basis of Cdc7-Dbf4 kinase dependent targeting and phosphorylation of the MCM2-7 double hexamer.
12	PDB:7v3vI	0.016	0.092	1.051E-1	328	0.006	0.046	7v3vI.pdb.gz	Structural Insight into the MCM double hexamer activation by Dbf4-Cdc7 kinase.
13	PDB:7p5zG	0.011	0.121	5.540E-1	213	0.006	0.066	7p5zG.pdb.gz	Structural mechanism for the selective phosphorylation of DNA-loaded MCM double hexamers by the Dbf4-dependent kinase.
14	PDB:5o9zQ	0.017	0.338	8.465	75	0.004	0.133	5o9zQ.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5SS00	0.0	1437	2493	0.450	0.425	ZDBF2_MOUSE DBF4-type zinc finger-containing protein 2 homolog OS=Mus musculus OX=10090 GN=Zdbf2 PE=2 SV=1
2	Q7ZZH7	0.11	40.0	661	0.006	0.021	DBF4A_XENLA Protein DBF4 homolog A OS=Xenopus laevis OX=8355 GN=dbf4 PE=1 SV=1
3	P32325	0.17	39.7	704	0.008	0.028	DBF4_YEAST DDK kinase regulatory subunit DBF4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DBF4 PE=1 SV=2
4	Q16790	0.34	38.5	459	0.012	0.061	CAH9_HUMAN Carbonic anhydrase 9 OS=Homo sapiens OX=9606 GN=CA9 PE=1 SV=2
5	Q9UBU7	0.52	38.1	674	0.006	0.021	DBF4A_HUMAN Protein DBF4 homolog A OS=Homo sapiens OX=9606 GN=DBF4 PE=1 SV=1
6	Q9QZ41	0.53	38.1	663	0.006	0.020	DBF4A_MOUSE Protein DBF4 homolog A OS=Mus musculus OX=10090 GN=Dbf4 PE=1 SV=1
7	Q5A5B4	0.84	37.4	506	0.005	0.022	Q5A5B4_CANAL Protein serine/threonine kinase activating protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DBF4 PE=4 SV=1
8	Q8NFT6	7.3	34.3	615	0.006	0.021	DBF4B_HUMAN Protein DBF4 homolog B OS=Homo sapiens OX=9606 GN=DBF4B PE=1 SV=1
9	P0CB49	8.1	34.3	1376	0.008	0.014	YLPM1_RAT YLP motif-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Ylpm1 PE=1 SV=1
10	Q9R0I7	8.4	34.3	1386	0.008	0.014	YLPM1_MOUSE YLP motif-containing protein 1 OS=Mus musculus OX=10090 GN=Ylpm1 PE=2 SV=2
11	O59836	8.5	33.9	545	0.005	0.020	HIM1_SCHPO Hsk1-interacting molecule 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=him1 PE=1 SV=1
12	Q9V9Y9	9.6	33.5	364	0.013	0.085	SPNF_DROME Protein spindle-F OS=Drosophila melanogaster OX=7227 GN=spn-F PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20442 BrxL_N	72	14.8	BREX system Lon protease-like protein BrxL N-terminal
2	PF13045 DUF3905	1.6e+02	13.7	Protein of unknown function (DUF3905)
3	PF15456 Uds1	3.5e+02	12.8	Up-regulated During Septation
4	PF07535 zf-DBF	0.02	26.3	DBF zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363545

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000402527	0.684	Sentrin-specific protease 6
2	9606.ENSP00000369627	0.681	Protein FAM50B
3	9606.ENSP00000480405	0.631	G-protein coupled receptor 1
4	9606.ENSP00000292562	0.628	Zinc finger protein 251
5	9606.ENSP00000301744	0.619	Zinc finger protein 597
6	9606.ENSP00000440498	0.591	Ganglioside-induced differentiation-associated protein 1-like 1
7	9606.ENSP00000326581	0.575	Paternally-expressed gene 3 protein
8	9606.ENSP00000406084	0.564	WD repeat-containing protein 20
9	9606.ENSP00000382972	0.561	Small nuclear ribonucleoprotein-associated protein N
10	9606.ENSP00000405963	0.555	Ras-specific guanine nucleotide-releasing factor 1
11	9606.ENSP00000349689	0.522	Palmitoyltransferase ZDHHC9
12	9606.ENSP00000418944	0.521	Retrotransposon-derived protein PEG10
13	9606.ENSP00000223215	0.518	Mesoderm-specific transcript homolog protein
14	9606.ENSP00000320488	0.505	Nucleosome assembly protein 1 like 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.550	molecular function regulator activity
GO:0140677	0.469	molecular function activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.983	regulation of biological process
GO:0009987	0.977	cellular process
GO:0050794	0.788	regulation of cellular process
GO:0008152	0.730	metabolic process
GO:0071704	0.666	organic substance metabolic process
GO:0044238	0.661	primary metabolic process
GO:0048519	0.644	negative regulation of biological process
GO:0032502	0.605	developmental process
GO:0019222	0.558	regulation of metabolic process
GO:0043170	0.537	macromolecule metabolic process
GO:0071840	0.456	cellular component organization or biogenesis
GO:0060255	0.427	regulation of macromolecule metabolic process
GO:0006807	0.402	nitrogen compound metabolic process
GO:0048856	0.383	anatomical structure development
GO:0032501	0.374	multicellular organismal process
GO:0044237	0.360	cellular metabolic process
GO:0050896	0.318	response to stimulus
GO:0044260	0.311	cellular macromolecule metabolic process
GO:0090304	0.306	nucleic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0005737	0.663	cytoplasm
GO:0005829	0.632	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]