StarFunc result for job id Q9HCK8

User Input

>input (2581 residues)
MADPIMDLFDDPNLFGLDSLTDDSFNQVTQDPIEEALGLPSSLDSLDQMNQDGGGGDVGN
SSASELVPPPEETAPTELSKESTAPAPESITLHDYTTQPASQEQPAQPVLQTSTPTSGLL
QVSKSQEILSQGNPFMGVSATAVSSSSAGGQPPQSAPKIVILKAPPSSSVTGAHVAQIQA
QGITSTAQPLVAGTANGGKVTFTKVLTGTPLRPGVSIVSGNTVLAAKVPGNQAAVQRIVQ
PSRPVKQLVLQPVKGSAPAGNPGATGPPLKPAVTLTSTPTQGESKRITLVLQQPQSGGPQ
GHRHVVLGSLPGKIVLQGNQLAALTQAKNAQGQPAKVVTIQLQVQQPQQKIQIVPQPPSS
QPQPQQPPSTQPVTLSSVQQAQIMGPGQSPGQRLSVPVKVVLQPQAGSSQGASSGLSVVK
VLSASEVAALSSPASSAPHSGGKTGMEENRRLEHQKKQEKANRIVAEAIARARARGEQNI
PRVLNEDELPSVRPEEEGEKKRRKKSAGERLKEEKPKKSKTSGASKTKGKSKLNTITPVV
GKKRKRNTSSDNSDVEVMPAQSPREDEESSIQKRRSNRQVKRKKYTEDLDIKITDDEEEE
EVDVTGPIKPEPILPEPVQEPDGETLPSMQFFVENPSEEDAAIVDKVLSMRIVKKELPSG
QYTEAEEFFVKYKNYSYLHCEWATISQLEKDKRIHQKLKRFKTKMAQMRHFFHEDEEPFN
PDYVEVDRILDESHSIDKDNGEPVIYYLVKWCSLPYEDSTWELKEDVDEGKIREFKRIQS
RHPELKRVNRPQASAWKKLELSHEYKNRNQLREYQLEGVNWLLFNWYNRQNCILADEMGL
GKTIQSIAFLQEVYNVGIHGPFLVIAPLSTITNWEREFNTWTEMNTIVYHGSLASRQMIQ
QYEMYCKDSRGRLIPGAYKFDALITTFEMILSDCPELREIEWRCVIIDEAHRLKNRNCKL
LDSLKHMDLEHKVLLTGTPLQNTVEELFSLLHFLEPSQFPSESEFLKDFGDLKTEEQVQK
LQAILKPMMLRRLKEDVEKNLAPKQETIIEVELTNIQKKYYRAILEKNFSFLSKGAGHTN
MPNLLNTMMELRKCCNHPYLINGAEEKILTEFREACHIIPHDFHLQAMVRSAGKLVLIDK
LLPKLKAGGHKVLIFSQMVRCLDILEDYLIQRRYLYERIDGRVRGNLRQAAIDRFSKPDS
DRFVFLLCTRAGGLGINLTAADTCIIFDSDWNPQNDLQAQARCHRIGQSKAVKVYRLITR
NSYEREMFDKASLKLGLDKAVLQSMSGRDGNITGIQQFSKKEIEDLLRKGAYAAIMEEDD
EGSKFCEEDIDQILLRRTTTITIESEGKGSTFAKASFVASENRTDISLDDPNFWQKWAKK
ADLDMDLLNSKNNLVIDTPRVRKQTRHFSTLKDDDLVEFSDLESEDDERPRSRRHDRHHA
YGRTDCFRVEKHLLVYGWGRWRDILSHGRFKRRMTERDVETICRAILVYCLLHYRGDENI
KGFIWDLISPAENGKTKELQNHSGLSIPVPRGRKGKKVKSQSTFDIHKADWIRKYNPDTL
FQDESYKKHLKHQCNKVLLRVRMLYYLRQEVIGDQAEKVLGGAIASEIDIWFPVVDQLEV
PTTWWDSEADKSLLIGVFKHGYEKYNTMRADPALCFLEKAGRPDDKAIAAEHRVLDNFSD
IVEGVDFDKDCEDPEYKPLQGPPKDQDDEGDPLMMMDEEISVIDGDEAQVTQQPGHLFWP
PGSALTARLRRLVTAYQRSYKREQMKIEAAERGDRRRRRCEAAFKLKEIARREKQQRWTR
REQTDFYRVVSTFGVEYDPDTMQFHWDRFRTFARLDKKTDESLTKYFHGFVAMCRQVCRL
PPAAGDEPPDPNLFIEPITEERASRTLYRIELLRRLREQVLCHPLLEDRLALCQPPGPEL
PKWWEPVRHDGELLRGAARHGVSQTDCNIMQDPDFSFLAARMNYMQNHQAGAPAPSLSRC
STPLLHQQYTSRTASPLPLRPDAPVEKSPEETATQVPSLESLTLKLEHEVVARSRPTPQD
YEMRVSPSDTTPLVSRSVPPVKLEDEDDSDSELDLSKLSPSSSSSSSSSSSSSSTDESED
EKEEKLTDQSRSKLYDEESLLSLTMSQDGFPNEDGEQMTPELLLLQERQRASEWPKDRVL
INRIDLVCQAVLSGKWPSSRRSQEMVTGGILGPGNHLLDSPSLTPGEYGDSPVPTPRSSS
AASMAEEEASAVSTAAAQFTKLRRGMDEKEFTVQIKDEEGLKLTFQKHKLMANGVMGDGH
PLFHKKKGNRKKLVELEVECMEEPNHLDVDLETRIPVINKVDGTLLVGEDAPRRAELEMW
LQGHPEFAVDPRFLAYMEDRRKQKWQRCKKNNKAELNCLGMEPVQTANSRNGKKGHHTET
VFNRVLPGPIAPESSKKRARRMRPDLSKMMALMQGGSTGSLSLHNTFQHSSSGLQSVSSL
GHSSATSASLPFMPFVMGGAPSSPHVDSSTMLHHHHHHPHPHHHHHHHPGLRAPGYPSSP
VTTASGTTLRLPPLQPEEDDDEDEEDDDDLSQGYDSSERDFSLIDDPMMPANSDSSEDAD
D

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0R0I6	0.432	0.442	0.000	2511	0.554	0.570	B0R0I6.pdb.gz	CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio OX=7955 GN=chd8 PE=3 SV=2
2	AFDB:Q09XV5	0.313	0.313	0.000	2582	0.962	0.962	Q09XV5.pdb.gz	CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus OX=10090 GN=Chd8 PE=1 SV=1
3	PDB:6g0lM	0.211	0.603	1.958E-43	855	0.118	0.357	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
4	PDB:6g0lW	0.217	0.604	9.525E-43	878	0.117	0.345	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
5	PDB:6jylK	0.168	0.797	3.428E-34	504	0.087	0.446	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
6	PDB:7epuB	0.139	0.391	4.334E-31	748	0.085	0.293	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
7	PDB:6tdaS	0.161	0.504	7.703E-31	783	0.081	0.268	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
8	PDB:7oo3b	0.159	0.676	1.367E-29	534	0.063	0.305	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
9	PDB:6uxwA	0.166	0.516	3.740E-29	778	0.079	0.263	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
10	PDB:6gejM	0.159	0.554	3.559E-28	688	0.071	0.266	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
11	PDB:6kw3Y	0.169	0.720	2.665E-27	548	0.082	0.385	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.
12	PDB:5vvrM	0.148	0.641	4.961E-26	503	0.059	0.302	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
13	AFDB:Q08562	0.149	0.232	8.352E-20	1619	0.089	0.141	Q08562.pdb.gz	ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ULS1 PE=1 SV=1
14	AFDB:O76743	0.119	0.236	5.576E-8	1156	0.064	0.142	O76743.pdb.gz	GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans OX=6239 GN=glh-4 PE=1 SV=2
15	AFDB:Q8CGS6	0.104	0.106	6.405E-5	2544	0.082	0.083	Q8CGS6.pdb.gz	DPOLQ_MOUSE DNA polymerase theta OS=Mus musculus OX=10090 GN=Polq PE=1 SV=2
16	AFDB:H3BSP3	0.024	0.070	2.572E-4	632	0.050	0.203	H3BSP3.pdb.gz	H3BSP3_HUMAN Chromodomain helicase DNA binding protein 9 (Fragment) OS=Homo sapiens OX=9606 GN=CHD9 PE=1 SV=1
17	AFDB:Q8I3S3	0.037	0.046	4.154E-4	1894	0.088	0.119	Q8I3S3.pdb.gz	Q8I3S3_PLAF7 mRNA-binding protein PUF1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0518700 PE=4 SV=1
18	AFDB:Q14004	0.037	0.046	2.689E-2	1512	0.097	0.165	Q14004.pdb.gz	CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=2
19	AFDB:Q5T5U3	0.041	0.046	4.780E-2	1958	0.108	0.142	Q5T5U3.pdb.gz	RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2
20	AFDB:Q9VRM6	0.030	0.033	4.780E-2	1929	0.112	0.150	Q9VRM6.pdb.gz	Q9VRM6_DROME Lethal (3) persistent salivary gland 2 OS=Drosophila melanogaster OX=7227 GN=l(3)psg2 PE=4 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y4P3	0.0	2196	1102	0.418	0.978	A0A2R8Y4P3_HUMAN DNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=CHD8 PE=1 SV=1
2	A0A2R8Y808	0.0	1102	586	0.216	0.951	A0A2R8Y808_HUMAN Chromodomain helicase DNA binding protein 8 (Fragment) OS=Homo sapiens OX=9606 GN=CHD8 PE=1 SV=1
3	A0A2R8Y840	0.0	4146	1995	0.772	0.999	A0A2R8Y840_HUMAN DNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=CHD8 PE=1 SV=1
4	A2AJK6	0.0	2092	2986	0.397	0.343	CHD7_MOUSE Chromodomain-helicase-DNA-binding protein 7 OS=Mus musculus OX=10090 GN=Chd7 PE=1 SV=1
5	B0R0I6	0.0	2387	2511	0.497	0.511	CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio OX=7955 GN=chd8 PE=3 SV=2
6	B7Z002	0.0	1234	5517	0.236	0.111	B7Z002_DROME Kismet, isoform C OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
7	F1QGL1	0.0	2082	3140	0.416	0.342	F1QGL1_DANRE DNA helicase OS=Danio rerio OX=7955 GN=chd7 PE=1 SV=1
8	H0YJG4	0.0	3778	1815	0.700	0.995	H0YJG4_HUMAN Chromodomain helicase DNA binding protein 8 (Fragment) OS=Homo sapiens OX=9606 GN=CHD8 PE=1 SV=2
9	M9NCY5	0.0	1240	5343	0.248	0.120	M9NCY5_DROME Kismet, isoform D OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
10	M9NDB7	0.0	1183	5252	0.225	0.111	M9NDB7_DROME Kismet, isoform E OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
11	M9NEL3	0.0	1359	5191	0.275	0.137	M9NEL3_DROME Kismet, isoform F OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
12	Q09XV5	0.0	5155	2582	0.962	0.962	CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus OX=10090 GN=Chd8 PE=1 SV=1
13	Q54UZ8	0.0	761	2373	0.164	0.179	Q54UZ8_DICDI Myb domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280705 PE=4 SV=1
14	Q8TD26	0.0	1953	2715	0.375	0.356	CHD6_HUMAN Chromodomain-helicase-DNA-binding protein 6 OS=Homo sapiens OX=9606 GN=CHD6 PE=1 SV=4
15	Q9HCK8	0.0	5358	2581	1.000	1.000	CHD8_HUMAN Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens OX=9606 GN=CHD8 PE=1 SV=5
16	Q9JIX5	0.0	5167	2581	0.964	0.964	CHD8_RAT Chromodomain-helicase-DNA-binding protein 8 OS=Rattus norvegicus OX=10116 GN=Chd8 PE=1 SV=2
17	Q9P2D1	0.0	2063	2997	0.391	0.337	CHD7_HUMAN Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens OX=9606 GN=CHD7 PE=1 SV=3
18	Q9VPL9	0.0	1253	5322	0.249	0.121	Q9VPL9_DROME FI24801p1 OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=3
19	Q54CF8	3.87e-179	619	3071	0.133	0.112	Q54CF8_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293012 PE=4 SV=1
20	Q54Q16	2.68e-163	559	1917	0.135	0.182	Q54Q16_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284171 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07533 BRK	2.3e-12	57.6	BRK domain
2	PF08074 CHDCT2	11	17.6	CHDCT2 (NUC038) domain
3	PF00385 Chromo	2e-20	83.7	Chromo (CHRromatin Organisation MOdifier) domain
4	PF00270 DEAD	0.16	23.2	DEAD/DEAH box helicase
5	PF00271 Helicase_C	1.8e-13	62.2	Helicase conserved C-terminal domain
6	PF15963 Myb_DNA-bind_7	27	16.0	Myb DNA-binding like
7	PF04851 ResIII	0.00013	33.5	Type III restriction enzyme, res subunit
8	PF00176 SNF2-rel_dom	2.3e-63	225.7	SNF2-related domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382863

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344456	0.996	Catenin beta-1
2	9606.ENSP00000264010	0.993	Transcriptional repressor CTCF
3	9606.ENSP00000351446	0.993	WD repeat-containing protein 5
4	9606.ENSP00000264515	0.980	Retinoblastoma-binding protein 5
5	9606.ENSP00000436786	0.969	Histone-lysine N-methyltransferase 2A
6	9606.ENSP00000263377	0.959	Bromodomain-containing protein 4
7	9606.ENSP00000318297	0.953	RuvB-like 1
8	9606.ENSP00000406549	0.950	Transcription initiation factor TFIID subunit 1
9	9606.ENSP00000309555	0.944	Host cell factor 1
10	9606.ENSP00000363124	0.943	PHD finger protein 20
11	9606.ENSP00000473172	0.933	RuvB-like 2
12	9606.ENSP00000269305	0.929	Cellular tumor antigen p53
13	9606.ENSP00000370193	0.927	Transcription initiation factor TFIID subunit 9
14	9606.ENSP00000262419	0.925	KAT8 regulatory NSL complex subunit 1
15	9606.ENSP00000399982	0.923	Transcription initiation factor TFIID subunit 6
16	9606.ENSP00000356480	0.921	E3 ubiquitin-protein ligase RING2
17	9606.ENSP00000219905	0.920	MAX gene-associated protein
18	9606.ENSP00000406037	0.920	Histone acetyltransferase KAT8
19	9606.ENSP00000391457	0.916	Chromosome 18 open reading frame 37, isoform CRA_a
20	9606.ENSP00000467041	0.916	Proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003682	0.997	chromatin binding
GO:0042393	0.997	histone binding
GO:0003677	0.997	DNA binding
GO:0002039	0.990	p53 binding
GO:0008013	0.969	beta-catenin binding
GO:0003824	0.905	catalytic activity
GO:0019904	0.709	protein domain specific binding
GO:0008094	0.642	ATP-dependent activity, acting on DNA
GO:0043565	0.524	sequence-specific DNA binding
GO:0003690	0.522	double-stranded DNA binding
GO:0001067	0.313	transcription regulatory region nucleic acid binding
GO:0000976	0.301	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0019219	0.984	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.980	regulation of gene expression
GO:0010556	0.971	regulation of macromolecule biosynthetic process
GO:0051252	0.970	regulation of RNA metabolic process
GO:0031326	0.969	regulation of cellular biosynthetic process
GO:0006355	0.960	regulation of DNA-templated transcription
GO:0009987	0.940	cellular process
GO:0048523	0.924	negative regulation of cellular process
GO:0009892	0.908	negative regulation of metabolic process
GO:0010605	0.901	negative regulation of macromolecule metabolic process
GO:0060828	0.896	regulation of canonical Wnt signaling pathway
GO:0032502	0.882	developmental process
GO:0048856	0.872	anatomical structure development
GO:0045892	0.865	negative regulation of DNA-templated transcription
GO:0032501	0.839	multicellular organismal process
GO:0090090	0.836	negative regulation of canonical Wnt signaling pathway
GO:0048518	0.780	positive regulation of biological process
GO:0007275	0.752	multicellular organism development
GO:0048522	0.714	positive regulation of cellular process
GO:0010604	0.707	positive regulation of macromolecule metabolic process
GO:0048731	0.678	system development
GO:0006357	0.655	regulation of transcription by RNA polymerase II
GO:0071840	0.595	cellular component organization or biogenesis
GO:0016043	0.542	cellular component organization
GO:0051173	0.504	positive regulation of nitrogen compound metabolic process
GO:0031325	0.480	positive regulation of cellular metabolic process
GO:0045935	0.452	positive regulation of nucleobase-containing compound metabolic process
GO:0060322	0.446	head development
GO:0051254	0.436	positive regulation of RNA metabolic process
GO:0031328	0.429	positive regulation of cellular biosynthetic process
GO:0010557	0.422	positive regulation of macromolecule biosynthetic process
GO:0008152	0.413	metabolic process
GO:0006338	0.404	chromatin remodeling
GO:0071704	0.399	organic substance metabolic process
GO:1902680	0.398	positive regulation of RNA biosynthetic process
GO:0050896	0.381	response to stimulus
GO:0045893	0.372	positive regulation of DNA-templated transcription
GO:0044238	0.362	primary metabolic process
GO:0007399	0.345	nervous system development
GO:0006807	0.342	nitrogen compound metabolic process
GO:0043170	0.326	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.992	protein-containing complex
GO:0043232	0.651	intracellular non-membrane-bounded organelle
GO:0140513	0.379	nuclear protein-containing complex
GO:1990234	0.344	transferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]