StarFunc result for job id Q9HCL0

User Input

>input (1135 residues)
MHQMNAKMHFRFVFALLIVSFNHDVLGKNLKYRIYEEQRVGSVIARLSEDVADVLLKLPN
PSTVRFRAMQRGNSPLLVVNEDNGEISIGATIDREQLCQKNLNCSIEFDVITLPTEHLQL
FHIEVEVLDINDNSPQFSRSLIPIEISESAAVGTRIPLDSAFDPDVGENSLHTYSLSAND
FFNIEVRTRTDGAKYAELIVVRELDRELKSSYELQLTASDMGVPQRSGSSILKISISDSN
DNSPAFEQQSYIIQLLENSPVGTLLLDLNATDPDEGANGKIVYSFSSHVSPKIMETFKID
SERGHLTLFKQVDYEITKSYEIDVQAQDLGPNSIPAHCKIIIKVVDVNDNKPEININLMS
PGKEEISYIFEGDPIDTFVALVRVQDKDSGLNGEIVCKLHGHGHFKLQKTYENNYLILTN
ATLDREKRSEYSLTVIAEDRGTPSLSTVKHFTVQINDINDNPPHFQRSRYEFVISENNSP
GAYITTVTATDPDLGENGQVTYTILESFILGSSITTYVTIDPSNGAIYALRIFDHEEVSQ
ITFVVEARDGGSPKQLVSNTTVVLTIIDENDNVPVVIGPALRNNTAEITIPKGAESGFHV
TRIRAIDRDSGVNAELSCAIVAGNEENIFIIDPRSCDIHTNVSMDSVPYTEWELSVIIQD
KGNPQLHTKVLLKCMIFEYAESVTSTAMTSVSQASLDVSMIIIISLGAICAVLLVIMVLF
ATRCNREKKDTRSYNCRVAESTYQHHPKRPSRQIHKGDITLVPTINGTLPIRSHHRSSPS
SSPTLERGQMGSRQSHNSHQSLNSLVTISSNHVPENFSLELTHATPAVEQVSQLLSMLHQ
GQYQPRPSFRGNKYSRSYRYALQDMDKFSLKDSGRGDSEAGDSDYDLGRDSPIDRLLGEG
FSDLFLTDGRIPAAMRLCTEECRVLGHSDQCWMPPLPSPSSDYRSNMFIPGEEFPTQPQQ
QHPHQSLEDDAQPADSGEKKKSFSTFGKDSPNDEDTGDTSTSSLLSEMSSVFQRLLPPSL
DTYSECSEVDRSNSLERRKGPLPAKTVGYPQGVAAWAASTHFQNPTTNCGPPLGTHSSVQ
PSSKWLPAMEEIPENYEEDDFDNVLNHLNDGKHELMDASELVAEINKLLQDVRQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8RMH2	0.614	0.606	0.000	1150	0.681	0.672	A0A2R8RMH2.pdb.gz
2	AFDB:F1QRP2	0.563	0.563	0.000	1135	0.678	0.678	F1QRP2.pdb.gz	F1QRP2_DANRE Protocadherin 18a OS=Danio rerio OX=7955 GN=id:ibd5114 PE=4 SV=2
3	AFDB:Q9HCL0	1.000	1.000	0.000	1135	1.000	1.000	Q9HCL0.pdb.gz	PCD18_HUMAN Protocadherin-18 OS=Homo sapiens OX=9606 GN=PCDH18 PE=1 SV=3
4	AFDB:C4P342	0.546	0.545	1.009E-99	1137	0.354	0.354	C4P342.pdb.gz	C4P342_DANRE Protocadherin-17 OS=Danio rerio OX=7955 GN=pcdh17 PE=2 SV=1
5	AFDB:O14917	0.531	0.521	2.174E-99	1159	0.360	0.353	O14917.pdb.gz	PCD17_HUMAN Protocadherin-17 OS=Homo sapiens OX=9606 GN=PCDH17 PE=1 SV=2
6	AFDB:A0A2R8QME5	0.539	0.558	1.118E-96	1094	0.340	0.353	A0A2R8QME5.pdb.gz	A0A2R8QME5_DANRE Protocadherin 19 OS=Danio rerio OX=7955 GN=fc83e05 PE=1 SV=1
7	AFDB:Q9P2J2	0.169	0.165	1.183E-18	1179	0.141	0.136	Q9P2J2.pdb.gz	TUTLA_HUMAN Protein turtle homolog A OS=Homo sapiens OX=9606 GN=IGSF9 PE=1 SV=2
8	AFDB:D3ZB51	0.145	0.131	2.076E-18	1328	0.139	0.119	D3ZB51.pdb.gz	TUTLB_RAT Protein turtle homolog B OS=Rattus norvegicus OX=10116 GN=Igsf9b PE=1 SV=1
9	AFDB:G5EBF1	0.138	0.128	2.076E-18	1273	0.150	0.134	G5EBF1.pdb.gz	SAX3_CAEEL Protein sax-3 OS=Caenorhabditis elegans OX=6239 GN=sax-3 PE=2 SV=1
10	AFDB:Q9W213	0.173	0.149	2.421E-18	1395	0.131	0.107	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
11	PDB:7sqcO0	0.134	0.134	5.182E-16	1140	0.067	0.067	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:4aq1A	0.099	0.136	2.665E-14	721	0.060	0.094	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
13	PDB:6velC	0.158	0.760	7.805E-13	209	0.047	0.254	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
14	PDB:5oj2B	0.112	0.164	1.518E-12	692	0.061	0.100	5oj2B.pdb.gz
15	PDB:1e07A	0.130	0.188	2.805E-12	642	0.056	0.100	1e07A.pdb.gz
16	PDB:4rtdA	0.081	0.082	2.286E-8	1122	0.064	0.065	4rtdA.pdb.gz
17	PDB:6dldD	0.111	0.327	6.045E-8	269	0.034	0.145	6dldD.pdb.gz
18	PDB:5a42A	0.080	0.062	3.271E-7	1597	0.067	0.048	5a42A.pdb.gz
19	PDB:7q1yA	0.088	0.077	3.814E-7	1374	0.060	0.049	7q1yA.pdb.gz
20	PDB:7vonA	0.081	0.069	7.418E-7	1399	0.081	0.066	7vonA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A2R8QI99	700	997	0.350	0.398	A0A2R8QI99_DANRE Protocadherin 10a OS=Danio rerio OX=7955 GN=ZPCR1 PE=4 SV=1
2	A0A2R8QME5	614	1094	0.338	0.351	A0A2R8QME5_DANRE Protocadherin 19 OS=Danio rerio OX=7955 GN=fc83e05 PE=1 SV=1
3	A1L1W7	618	1078	0.334	0.352	A1L1W7_DANRE Wu:fc83e05 protein (Fragment) OS=Danio rerio OX=7955 GN=wu:fc83e05 PE=2 SV=1
4	A9CPE6	1538	1150	0.679	0.670	A9CPE6_DANRE Protocadherin 18 OS=Danio rerio OX=7955 GN=pcdh 18 PE=2 SV=2
5	A9QUV5	1517	1123	0.665	0.672	A9QUV5_DANRE Protocadherin 18 OS=Danio rerio OX=7955 GN=pcdh18 PE=2 SV=1
6	B5TR11	563	979	0.259	0.300	B5TR11_XENLA Paraxial protocadherin OS=Xenopus laevis OX=8355 GN=PAPC PE=1 SV=1
7	C4P342	622	1137	0.370	0.369	C4P342_DANRE Protocadherin-17 OS=Danio rerio OX=7955 GN=pcdh17 PE=2 SV=1
8	D3ZE55	572	1069	0.273	0.290	PCDH8_RAT Protocadherin-8 OS=Rattus norvegicus OX=10116 GN=Pcdh8 PE=1 SV=2
9	E9PX28	660	1047	0.355	0.385	E9PX28_MOUSE Protocadherin 10 OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1
10	E9PXF0	641	1157	0.378	0.371	E9PXF0_MOUSE Protocadherin 17 OS=Mus musculus OX=10090 GN=Pcdh17 PE=1 SV=1
11	E9PXQ7	661	1057	0.355	0.381	E9PXQ7_MOUSE Protocadherin 10 OS=Mus musculus OX=10090 GN=Pcdh10 PE=1 SV=1
12	F1QRP2	1558	1135	0.680	0.680	F1QRP2_DANRE Protocadherin 18a OS=Danio rerio OX=7955 GN=id:ibd5114 PE=4 SV=2
13	F8W3X3	620	1088	0.338	0.353	PCD19_DANRE Protocadherin-19 OS=Danio rerio OX=7955 GN=pcdh19 PE=1 SV=2
14	O14917	636	1159	0.381	0.373	PCD17_HUMAN Protocadherin-17 OS=Homo sapiens OX=9606 GN=PCDH17 PE=1 SV=2
15	O55134	566	1180	0.279	0.269	PCD12_MOUSE Protocadherin-12 OS=Mus musculus OX=10090 GN=Pcdh12 PE=1 SV=2
16	O93509	560	979	0.257	0.298	O93509_XENLA Paraxial protocadherin OS=Xenopus laevis OX=8355 PE=2 SV=1
17	O95206	568	1070	0.270	0.287	PCDH8_HUMAN Protocadherin-8 OS=Homo sapiens OX=9606 GN=PCDH8 PE=1 SV=2
18	Q3UTP0	578	755	0.278	0.419	Q3UTP0_MOUSE Cadherin domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Pcdh17 PE=2 SV=1
19	Q5HZI5	640	1157	0.377	0.370	Q5HZI5_MOUSE Protocadherin 17 OS=Mus musculus OX=10090 GN=Pcdh17 PE=2 SV=1
20	Q6NYV7	701	1001	0.350	0.397	Q6NYV7_DANRE Protocadherin 10a OS=Danio rerio OX=7955 GN=ZPCR1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14779 BBS1	33	15.4	Ciliary BBSome complex subunit 1
2	PF00028 Cadherin	1.1e-80	277.5	Cadherin domain
3	PF08266 Cadherin_2	1.3e-11	55.5	Cadherin-like
4	PF16184 Cadherin_3	0.00098	30.4	Cadherin-like
5	PF16492 Cadherin_C_2	5.1	19.2	Cadherin cytoplasmic C-terminal
6	PF11898 DUF3418	5.8e+02	10.5	Domain of unknown function (DUF3418)
7	PF08391 Ly49	3.7e+02	12.9	Ly49-like protein, N-terminal region
8	PF17523 MPS-4	2.4e+02	13.3	MinK-related peptide, potassium channel accessory sub-unit protein 4
9	PF13908 Shisa	6.1e+02	11.9	Wnt and FGF inhibitory regulator
10	PF01034 Syndecan	3.5e+02	12.5	Syndecan domain
11	PF15102 TMEM154	42	15.4	TMEM154 protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355082

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000320081	0.740	Deleted in autism protein 1
2	9606.ENSP00000356658	0.605	G-protein coupled receptor 52
3	9606.ENSP00000357597	0.545	Testis-specific Y-encoded-like protein 1
4	9606.ENSP00000326759	0.520	Leucine-rich repeats and immunoglobulin-like domains protein 3
5	9606.ENSP00000229955	0.508	Probable G-protein coupled receptor 63

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007275	0.988	multicellular organism development
GO:0009987	0.987	cellular process
GO:0048731	0.873	system development
GO:0007399	0.767	nervous system development
GO:0050789	0.736	regulation of biological process
GO:0048513	0.615	animal organ development
GO:0050794	0.590	regulation of cellular process
GO:0060322	0.541	head development
GO:0050896	0.421	response to stimulus
GO:0007417	0.312	central nervous system development
GO:0071840	0.306	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]