StarFunc result for job id Q9HCL2

User Input

>input (828 residues)
MDESALTLGTIDVSYLPHSSEYSVGRCKHTSEEWGECGFRPTIFRSATLKWKESLMSRKR
PFVGRCCYSCTPQSWDKFFNPSIPSLGLRNVIYINETHTRHRGWLARRLSYVLFIQERDV
HKGMFATNVTENVLNSSRVQEAIAEVAAELNPDGSAQQQSKAVNKVKKKAKRILQEMVAT
VSPAMIRLTGWVLLKLFNSFFWNIQIHKGQLEMVKAATETNLPLLFLPVHRSHIDYLLLT
FILFCHNIKAPYIASGNNLNIPIFSTLIHKLGGFFIRRRLDETPDGRKDVLYRALLHGHI
VELLRQQQFLEIFLEGTRSRSGKTSCARAGLLSVVVDTLSTNVIPDILIIPVGISYDRII
EGHYNGEQLGKPKKNESLWSVARGVIRMLRKNYGCVRVDFAQPFSLKEYLESQSQKPVSA
LLSLEQALLPAILPSRPSDAADEGRDTSINESRNATDESLRRRLIANLAEHILFTASKSC
AIMSTHIVACLLLYRHRQGIDLSTLVEDFFVMKEEVLARDFDLGFSGNSEDVVMHAIQLL
GNCVTITHTSRNDEFFITPSTTVPSVFELNFYSNGVLHVFIMEAIIACSLYAVLNKRGLG
GPTSTPPNLISQEQLVRKAASLCYLLSNEGTISLPCQTFYQVCHETVGKFIQYGILTVAE
HDDQEDISPSLAEQQWDKKLPEPLSWRSDEEDEDSDFGEEQRDCYLKVSQSKEHQQFITF
LQRLLGPLLEAYSSAAIFVHNFSGPVPEPEYLQKLHKYLITRTERNVAVYAESATYCLVK
NAVKMFKDIGVFKETKQKRVSVLELSSTFLPQCNRQKLLEYILSFVVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97564	0.981	0.981	0.000	828	0.915	0.915	P97564.pdb.gz	GPAT1_RAT Glycerol-3-phosphate acyltransferase 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Gpam PE=1 SV=3
2	AFDB:D3ZI76	0.795	0.820	2.828E-51	801	0.301	0.311	D3ZI76.pdb.gz	GPAT2_RAT Glycerol-3-phosphate acyltransferase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Gpat2 PE=1 SV=1
3	AFDB:Q6NUI2	0.787	0.818	2.901E-50	795	0.313	0.326	Q6NUI2.pdb.gz	GPAT2_HUMAN Glycerol-3-phosphate acyltransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=GPAT2 PE=2 SV=2
4	AFDB:Q9Y137	0.743	0.724	2.108E-47	850	0.252	0.246	Q9Y137.pdb.gz	Q9Y137_DROME BcDNA.GH07066 OS=Drosophila melanogaster OX=7227 GN=mino PE=1 SV=1
5	AFDB:Q54I12	0.704	0.462	1.302E-40	1279	0.217	0.141	Q54I12.pdb.gz	Q54I12_DICDI Phospholipid/glycerol acyltransferase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0289081 PE=3 SV=1
6	AFDB:Q22949	0.688	0.789	4.004E-39	718	0.239	0.276	Q22949.pdb.gz	PLSB_CAEEL Probable glycerol-3-phosphate acyltransferase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=acl-6 PE=3 SV=1
7	AFDB:I7LW01	0.683	0.502	9.223E-39	1140	0.198	0.144	I7LW01.pdb.gz	I7LW01_TETTS Male sterility protein OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTHERM_00221020 PE=3 SV=1
8	AFDB:P98192	0.675	0.819	4.716E-36	678	0.193	0.236	P98192.pdb.gz	GNPAT_MOUSE Dihydroxyacetone phosphate acyltransferase OS=Mus musculus OX=10090 GN=Gnpat PE=1 SV=1
9	AFDB:O15228	0.679	0.822	8.348E-36	680	0.184	0.224	O15228.pdb.gz	GNPAT_HUMAN Dihydroxyacetone phosphate acyltransferase OS=Homo sapiens OX=9606 GN=GNPAT PE=1 SV=1
10	AFDB:Q583Z3	0.636	0.433	5.914E-34	1242	0.188	0.126	Q583Z3.pdb.gz	Q583Z3_TRYB2 Dihydroxyacetone phosphate acyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2H8.550 PE=3 SV=1
11	PDB:7cteC	0.097	0.126	7.497E-3	592	0.109	0.152	7cteC.pdb.gz	Structural insight into the assembly and conformational activation of human origin recognition complex.
12	PDB:7d58O	0.074	0.114	3.057E-2	490	0.047	0.080	7d58O.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
13	PDB:7a6hO	0.074	0.104	8.034E-2	512	0.052	0.084	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
14	PDB:5zr1B	0.089	0.175	1.486E-1	374	0.054	0.120	5zr1B.pdb.gz	Structure of the origin recognition complex bound to DNA replication origin.
15	PDB:7dn3O	0.081	0.135	1.695E-1	443	0.035	0.065	7dn3O.pdb.gz	Structure of human RNA polymerase III elongation complex.
16	PDB:6rqcA	0.099	0.133	1.934E-1	494	0.071	0.119	6rqcA.pdb.gz	Mechanism of head-to-head MCM double-hexamer formation revealed by cryo-EM.
17	PDB:7obqx	0.103	0.186	2.206E-1	393	0.051	0.107	7obqx.pdb.gz	Molecular mechanism of cargo recognition and handover by the mammalian signal recognition particle.
18	PDB:5vheA	0.097	0.094	2.409E-1	871	0.109	0.103	5vheA.pdb.gz	Structural basis of G-quadruplex unfolding by the DEAH/RHA helicase DHX36.
19	PDB:3ndbB	0.102	0.174	2.517E-1	420	0.052	0.102	3ndbB.pdb.gz	Structural basis of signal-sequence recognition by the signal recognition particle.
20	PDB:7tjhC	0.065	0.084	3.423E-1	546	0.070	0.106	7tjhC.pdb.gz	A mechanism of origin licensing control through autoinhibition of S. cerevisiae ORC·DNA·Cdc6.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P97564	0.0	1582	828	0.917	0.917	GPAT1_RAT Glycerol-3-phosphate acyltransferase 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Gpam PE=1 SV=3
2	Q61586	0.0	1604	827	0.928	0.929	GPAT1_MOUSE Glycerol-3-phosphate acyltransferase 1, mitochondrial OS=Mus musculus OX=10090 GN=Gpam PE=1 SV=2
3	Q9HCL2	0.0	1719	828	1.000	1.000	GPAT1_HUMAN Glycerol-3-phosphate acyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GPAM PE=1 SV=3
4	Q14DK4	5.14e-111	359	801	0.314	0.325	GPAT2_MOUSE Glycerol-3-phosphate acyltransferase 2, mitochondrial OS=Mus musculus OX=10090 GN=Gpat2 PE=1 SV=3
5	D3ZI76	6.34e-110	357	801	0.310	0.321	GPAT2_RAT Glycerol-3-phosphate acyltransferase 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Gpat2 PE=1 SV=1
6	Q6NUI2	1.45e-107	350	795	0.312	0.325	GPAT2_HUMAN Glycerol-3-phosphate acyltransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=GPAT2 PE=2 SV=2
7	Q9Y137	1.92e-89	303	850	0.242	0.235	Q9Y137_DROME BcDNA.GH07066 OS=Drosophila melanogaster OX=7227 GN=mino PE=1 SV=1
8	Q22949	4.75e-69	244	718	0.231	0.266	PLSB_CAEEL Probable glycerol-3-phosphate acyltransferase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=acl-6 PE=3 SV=1
9	G8JY39	4.33e-59	213	558	0.203	0.301	G8JY39_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-6 PE=1 SV=1
10	Q54I12	7.28e-59	220	1279	0.173	0.112	Q54I12_DICDI Phospholipid/glycerol acyltransferase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0289081 PE=3 SV=1
11	I7LW01	9.53e-53	201	1140	0.198	0.144	I7LW01_TETTS Male sterility protein OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=TTHERM_00221020 PE=3 SV=1
12	Q583Z3	6.26e-37	152	1242	0.161	0.107	Q583Z3_TRYB2 Dihydroxyacetone phosphate acyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2H8.550 PE=3 SV=1
13	G1SPE9	5.96e-35	144	679	0.157	0.191	G1SPE9_RABIT Dihydroxyacetone phosphate acyltransferase OS=Oryctolagus cuniculus OX=9986 GN=GNPAT PE=3 SV=2
14	Q9ES71	1.02e-34	143	678	0.111	0.136	GNPAT_RAT Dihydroxyacetone phosphate acyltransferase OS=Rattus norvegicus OX=10116 GN=Gnpat PE=1 SV=1
15	P98192	4.79e-34	141	678	0.111	0.136	GNPAT_MOUSE Dihydroxyacetone phosphate acyltransferase OS=Mus musculus OX=10090 GN=Gnpat PE=1 SV=1
16	O15228	3.54e-33	139	680	0.111	0.135	GNPAT_HUMAN Dihydroxyacetone phosphate acyltransferase OS=Homo sapiens OX=9606 GN=GNPAT PE=1 SV=1
17	Q4Q396	1.11e-32	139	1436	0.110	0.063	Q4Q396_LEIMA Dihydroxyacetonephosphate acyltransferase OS=Leishmania major OX=5664 GN=DAT PE=3 SV=1
18	P0A7A7	2.00e-32	137	807	0.118	0.121	PLSB_ECOLI Glycerol-3-phosphate acyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=plsB PE=1 SV=2
19	P9WI61	1.11e-15	84.0	789	0.107	0.113	PLSB_MYCTU Glycerol-3-phosphate acyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=plsB PE=1 SV=1
20	P9WI59	1.63e-14	79.7	621	0.074	0.098	PLSB1_MYCTU Putative acyltransferase plsB1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=plsB1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01553 Acyltransferase	8.7e-19	78.9	Acyltransferase
2	PF19277 GPAT_C	1.4e-27	108.2	Glycerol-3-phosphate acyltransferase C-terminal region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265276

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360761	0.983	1-acyl-sn-glycerol-3-phosphate acyltransferase beta
2	9606.ENSP00000378877	0.983	1-acyl-sn-glycerol-3-phosphate acyltransferase alpha
3	9606.ENSP00000381140	0.974	1-acyl-sn-glycerol-3-phosphate acyltransferase gamma
4	9606.ENSP00000482571	0.972	Glycerol-3-phosphate acyltransferase 3
5	9606.ENSP00000380184	0.971	Glycerol-3-phosphate acyltransferase 4
6	9606.ENSP00000348069	0.970	Sterol regulatory element-binding protein 1
7	9606.ENSP00000314036	0.969	1-acyl-sn-glycerol-3-phosphate acyltransferase delta
8	9606.ENSP00000302177	0.954	Lysophospholipid acyltransferase 2
9	9606.ENSP00000301149	0.953	Glycerol-3-phosphate dehydrogenase 1
10	9606.ENSP00000285518	0.951	1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon
11	9606.ENSP00000310551	0.949	Lysocardiolipin acyltransferase 1
12	9606.ENSP00000390849	0.944	1-acylglycerol-3-phosphate O-acyltransferase ABHD5
13	9606.ENSP00000324944	0.943	Lysophospholipid acyltransferase 1
14	9606.ENSP00000261407	0.937	Lysophospholipid acyltransferase 5
15	9606.ENSP00000308610	0.932	Glycerol-3-phosphate dehydrogenase, mitochondrial
16	9606.ENSP00000317300	0.931	Lysophospholipid acyltransferase LPCAT4
17	9606.ENSP00000282541	0.925	Glycerol-3-phosphate dehydrogenase 1-like protein
18	9606.ENSP00000401720	0.924	Glycerol kinase
19	9606.ENSP00000245615	0.909	Lysophospholipid acyltransferase 7
20	9606.ENSP00000351706	0.908	Glycerol kinase 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004366	1.000	glycerol-3-phosphate O-acyltransferase activity
GO:0005515	0.890	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006639	0.991	acylglycerol metabolic process
GO:0006650	0.985	glycerophospholipid metabolic process
GO:0009058	0.976	biosynthetic process
GO:1901576	0.974	organic substance biosynthetic process
GO:0008610	0.942	lipid biosynthetic process
GO:0044249	0.941	cellular biosynthetic process
GO:0046473	0.933	phosphatidic acid metabolic process
GO:0045017	0.932	glycerolipid biosynthetic process
GO:0090407	0.925	organophosphate biosynthetic process
GO:0008654	0.921	phospholipid biosynthetic process
GO:0046460	0.902	neutral lipid biosynthetic process
GO:0046474	0.886	glycerophospholipid biosynthetic process
GO:0006641	0.867	triglyceride metabolic process
GO:0006654	0.865	phosphatidic acid biosynthetic process
GO:0046463	0.782	acylglycerol biosynthetic process
GO:0065007	0.669	biological regulation
GO:0050789	0.655	regulation of biological process
GO:0050794	0.543	regulation of cellular process
GO:0019222	0.462	regulation of metabolic process
GO:0048518	0.460	positive regulation of biological process
GO:0006807	0.393	nitrogen compound metabolic process
GO:0048522	0.393	positive regulation of cellular process
GO:0044281	0.388	small molecule metabolic process
GO:1901564	0.318	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031966	1.000	mitochondrial membrane
GO:0019867	0.682	outer membrane
GO:0098588	0.679	bounding membrane of organelle
GO:0031968	0.670	organelle outer membrane
GO:0005741	0.585	mitochondrial outer membrane
GO:0012505	0.571	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15325	1.000	an acyl-CoA + sn-glycerol 3-phosphate = a 1-acyl-sn-glycero-3-phosphate + CoA
EC:2.3.1.15	1.000	glycerol-3-phosphate 1-O-acyltransferase.

[back to server]