StarFunc result for job id Q9HCM1

User Input

>input (1747 residues)
MNWNEKPKSATLPPLYPKSQPPFLHQSLINQITTTSQSSFSYPGSNQEACMYPGNSNPIS
QPLLNIQNYPQQISVSDMHNGTVVASHTSVERITYANVNGPKQLTHNLQMSSGVTQNVWL
NSPMRNPVHSHIGATVSHQTDFGANVPNMPALQSQLITSDTYSMQMQMIPSNSTRLPVAY
QGNQGLNQSFSEQQVDWTQQCISKGLTYPDYRPPPKLYRYSPQSFLPDSTIQKQNFIPHT
SLQVKNSQLLNSVLTLPSRQTSAVPSQQYATQTDKRPPPPPYNCRYGSQPLQSTQHITKH
LSMEVPQSREMLSSEIRTSFQQQWQNPNENVSTIGNFTNLKVNTNSKQPFNSPIRSSVDG
VQTLAQTNEEKIMDSCNPTSNQVLDTSVAKEKLVRDIKTLVEIKQKFSELARKIKINKDL
LMAAGCIKMTNTSYSEPAQNSKLSLKQTAKIQSGPQITPVMPENAERQTPTVVESAETNK
TQCMLNSDIQEVNCRRFNQVDSVLPNPVYSEKRPMPDSSHDVKVLTSKTSAVEMTQAVLN
TQLSSENVTKVEQNSPAVCETISVPKSMSTEEYKSKIQNENMLLLALLSQARKTQKTVLK
DANQTIQDSKPDSCEMNPNTQMTGNQLNLKNMETPSTSNVSGRVLDNSFCSGQESSTKGM
PAKSDSSCSMEVLATCLSLWKKQPSDTAKEKECDKLRTNTTAVGISKPANIHVKSPCSVV
GNSNSQNKISNPSQQTALSMVMHNYESSGINITKGTELQIAVVSPLVLSEVKTLSVKGIT
PAVLPETVYPVIKEGSVCSLQNQLAENAKATAALKVDVSGPVASTATSTKIFPLTQKEKQ
NESTNGNSEVTPNVNQGKHNKLESAIHSPMNDQQISQESRNSTVVSSDTLQIDNICSLVE
GDTSYNSQIAKIFSSLPLKMVEPQKPSLPNQQGIGSREPEKQLDNTTENKDFGFQKDKPV
QCTDVSHKICDQSKSEPPLESSFNNLETNRVILEKSSLEHATEKSTANDTCSSAAIQEDI
YPQEIDASSNYTPQDPARNEIHSDKAPVLYLHDQLSELLKEFPYGIEAVNTREGSVGQQT
TYQTSEDQTADKTSSDSKDPADQIQITILSSEQMKEIFPEQDDQPYVVDKLAEPQKEEPI
TEVVSQCDLQAPAAGQSRDSVILDSEKDDIHCCALGWLSMVYEGVPQCQCNSIKNSSSEE
EKQKEQCSPLDTNSCKQGERTSDRDVTVVQFKSLVNNPKTPPDGKSHFPELQDDSRKDTP
KTKHKSLPRTEQELVAGQFSSKCDKLNPLQNHKRKKLRFHEVTFHSSNKMTASYEQASQE
TRQKKHVTQNSRPLKTKTAFLPNKDVYKKHSSLGQSLSPEKIKLKLKSVSFKQKRKLDQG
NVLDMEVKKKKHDKQEQKGSVGATFKLGDSLSNPNERAIVKEKMVSNTKSVDTKASSSKF
SRILTPKEYLQRQKHKEALSNKASKKICVKNVPCDSEHMRPSKLAVQVESCGKSNEKHSS
GVQTSKESLNGLTSHGKNLKIHHSQESKTYNILRNVKEKVGGKQPDKIWIDKTKLDKLTN
ISNEAQFSQMPPQVKDQKKLYLNRVGFKCTERESISLTKLESSPRKLHKDKRQENKHKTF
LPVKGNTEKSNMLEFKLCPDILLKNTNSVEERKDVKPHPRKEQAPLQVSGIKSTKEDWLK
FVATKKRTQKDSQERDNVNSRLSKRSFSADGFEMLQNPVKDSKEMFQTYKQMYLEKRSRS
LGSSPVK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HCM1	1.000	1.000	0.000	1747	1.000	1.000	Q9HCM1.pdb.gz	RESF1_HUMAN Retroelement silencing factor 1 OS=Homo sapiens OX=9606 GN=RESF1 PE=1 SV=3
2	AFDB:Q5DTW7	0.102	0.113	1.518E-80	1521	0.445	0.512	Q5DTW7.pdb.gz	RESF1_MOUSE Retroelement silencing factor 1 OS=Mus musculus OX=10090 GN=Resf1 PE=1 SV=2
3	AFDB:Q9SD86	0.042	0.047	2.314E-4	1501	0.124	0.145	Q9SD86.pdb.gz	Q9SD86_ARATH Dentin sialophosphoprotein-like protein OS=Arabidopsis thaliana OX=3702 GN=F13G24.180 PE=1 SV=1
4	AFDB:M9PGK7	0.033	0.027	1.519E-3	2272	0.135	0.103	M9PGK7.pdb.gz	M9PGK7_DROME Klarsicht, isoform E OS=Drosophila melanogaster OX=7227 GN=klar PE=1 SV=1
5	AFDB:A0A1D5NSI1	0.032	0.029	3.103E-3	1996	0.137	0.120	A0A1D5NSI1.pdb.gz
6	AFDB:Q5H9F3	0.034	0.034	3.533E-3	1711	0.132	0.134	Q5H9F3.pdb.gz	BCORL_HUMAN BCL-6 corepressor-like protein 1 OS=Homo sapiens OX=9606 GN=BCORL1 PE=1 SV=2
7	AFDB:Q99KW3	0.029	0.026	4.887E-3	2014	0.141	0.122	Q99KW3.pdb.gz	TARA_MOUSE TRIO and F-actin-binding protein OS=Mus musculus OX=10090 GN=Triobp PE=1 SV=3
8	AFDB:D3ZXN9	0.033	0.027	5.214E-3	2472	0.133	0.094	D3ZXN9.pdb.gz	D3ZXN9_RAT Nuclear receptor co-repressor 2 OS=Rattus norvegicus OX=10116 GN=Ncor2 PE=1 SV=2
9	AFDB:P97868	0.031	0.031	5.214E-3	1790	0.144	0.141	P97868.pdb.gz	RBBP6_MOUSE E3 ubiquitin-protein ligase RBBP6 OS=Mus musculus OX=10090 GN=Rbbp6 PE=1 SV=5
10	AFDB:Q8IBR9	0.040	0.030	8.764E-3	2695	0.139	0.090	Q8IBR9.pdb.gz	Q8IBR9_PLAF7 Exported serine/threonine protein kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0718100 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5DTW7	0.0	880	1521	0.320	0.368	RESF1_MOUSE Retroelement silencing factor 1 OS=Mus musculus OX=10090 GN=Resf1 PE=1 SV=2
2	Q9HCM1	0.0	3592	1747	1.000	1.000	RESF1_HUMAN Retroelement silencing factor 1 OS=Homo sapiens OX=9606 GN=RESF1 PE=1 SV=3
3	O94269	5.6	33.9	512	0.012	0.041	UBP3_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp3 PE=3 SV=1
4	Q9C8G5	7.8	33.9	724	0.013	0.030	CSCLD_ARATH CSC1-like protein ERD4 OS=Arabidopsis thaliana OX=3702 GN=ERD4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15395 DUF4617	0	1614.9	Domain of unknown function (DUF4617)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310338

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360483	0.599	Nucleoporin NDC1
2	9606.ENSP00000444533	0.572	Keratin, type II cuticular Hb6
3	9606.ENSP00000439128	0.563	Barrier-to-autointegration factor-like protein
4	9606.ENSP00000295628	0.540	Leucine-rich repeat-containing protein 58
5	9606.ENSP00000311747	0.521	RNA-binding protein 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.976	biological regulation
GO:0050789	0.959	regulation of biological process
GO:0050896	0.920	response to stimulus
GO:0048518	0.919	positive regulation of biological process
GO:0010468	0.898	regulation of gene expression
GO:0050794	0.897	regulation of cellular process
GO:0009987	0.849	cellular process
GO:0048523	0.635	negative regulation of cellular process
GO:0051252	0.578	regulation of RNA metabolic process
GO:2001141	0.572	regulation of RNA biosynthetic process
GO:0071704	0.488	organic substance metabolic process
GO:0044238	0.452	primary metabolic process
GO:0048522	0.388	positive regulation of cellular process
GO:0051128	0.349	regulation of cellular component organization
GO:0071840	0.331	cellular component organization or biogenesis
GO:0045071	0.319	negative regulation of viral genome replication
GO:0043170	0.307	macromolecule metabolic process
GO:0006807	0.300	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.999	protein-containing complex
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0043233	0.996	organelle lumen
GO:0070013	0.989	intracellular organelle lumen
GO:0005856	0.989	cytoskeleton
GO:0015630	0.983	microtubule cytoskeleton
GO:0031981	0.981	nuclear lumen
GO:0005815	0.972	microtubule organizing center
GO:0005654	0.961	nucleoplasm
GO:0005737	0.941	cytoplasm
GO:0000930	0.864	gamma-tubulin complex
GO:0012505	0.507	endomembrane system
GO:0005694	0.415	chromosome
GO:0098687	0.365	chromosomal region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]