StarFunc result for job id Q9HCM2

User Input

>input (1894 residues)
MKAMPWNWTCLLSHLLMVGMGSSTLLTRQPAPLSQKQRSFVTFRGEPAEGFNHLVVDERT
GHIYLGAVNRIYKLSSDLKVLVTHETGPDEDNPKCYPPRIVQTCNEPLTTTNNVNKMLLI
DYKENRLIACGSLYQGICKLLRLEDLFKLGEPYHKKEHYLSGVNESGSVFGVIVSYSNLD
DKLFIATAVDGKPEYFPTISSRKLTKNSEADGMFAYVFHDEFVASMIKIPSDTFTIIPDF
DIYYVYGFSSGNFVYFLTLQPEMVSPPGSTTKEQVYTSKLVRLCKEDTAFNSYVEVPIGC
ERSGVEYRLLQAAYLSKAGAVLGRTLGVHPDDDLLFTVFSKGQKRKMKSLDESALCIFIL
KQINDRIKERLQSCYRGEGTLDLAWLKVKDIPCSSALLTIDDNFCGLDMNAPLGVSDMVR
GIPVFTEDRDRMTSVIAYVYKNHSLAFVGTKSGKLKKIRVDGPRGNALQYETVQVVDPGP
VLRDMAFSKDHEQLYIMSERQLTRVPVESCGQYQSCGECLGSGDPHCGWCVLHNTCTRKE
RCERSKEPRRFASEMKQCVRLTVHPNNISVSQYNVLLVLETYNVPELSAGVNCTFEDLSE
MDGLVVGNQIQCYSPAAKEVPRIITENGDHHVVQLQLKSKETGMTFASTSFVFYNCSVHN
SCLSCVESPYRCHWCKYRHVCTHDPKTCSFQEGRVKLPEDCPQLLRVDKILVPVEVIKPI
TLKAKNLPQPQSGQRGYECILNIQGSEQRVPALRFNSSSVQCQNTSYSYEGMEINNLPVE
LTVVWNGHFNIDNPAQNKVHLYKCGAMRESCGLCLKADPDFACGWCQGPGQCTLRQHCPA
QESQWLELSGAKSKCTNPRITEIIPVTGPREGGTKVTIRGENLGLEFRDIASHVKVAGVE
CSPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMTLTLSDLK
PSRGPMSGGTQVTITGTNLNAGSNVVVMFGKQPCLFHRRSPSYIVCNTTSSDEVLEMKVS
VQVDRAKIHQDLVFQYVEDPTIVRIEPEWSIVSGNTPIAVWGTHLDLIQNPQIRAKHGGK
EHINICEVLNATEMTCQAPALALGPDHQSDLTERPEEFGFILDNVQSLLILNKTNFTYYP
NPVFEAFGPSGILELKPGTPIILKGKNLIPPVAGGNVKLNYTVLVGEKPCTVTVSDVQLL
CESPNLIGRHKVMARVGGMEYSPGMVYIAPDSPLSLPAIVSIAVAGGLLIIFIVAVLIAY
KRKSRESDLTLKRLQMQMDNLESRVALECKEAFAELQTDIHELTSDLDGAGIPFLDYRTY
TMRVLFPGIEDHPVLRDLEVPGYRQERVEKGLKLFAQLINNKVFLLSFIRTLESQRSFSM
RDRGNVASLIMTVLQSKLEYATDVLKQLLADLIDKNLESKNHPKLLLRRTESVAEKMLTN
WFTFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTL
VLSCVSPDNANSPEVPVKILNCDTITQVKEKILDAIFKNVPCSHRPKAADMDLEWRQGSG
ARMILQDEDITTKIENDWKRLNTLAHYQVPDGSVVALVSKQVTAYNAVNNSTVSRTSASK
YENMIRYTGSPDSLRSRTPMITPDLESGVKMWHLVKNHEHGDQKEGDRGSKMVSEIYLTR
LLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHGIHDPHVRHTWKS
NCLPLRFWVNMIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLY
AKDIPSYKNWVERYYSDIGKMPAISDQDMNAYLAEQSRMHMNEFNTMSALSEIFSYVGKY
SEEILGPLDHDDQCGKQKLAYKLEQVITLMSLDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IRZ9	0.458	0.448	0.000	1945	0.291	0.283	A0A0R4IRZ9.pdb.gz
2	AFDB:A0A2R8QPJ6	0.681	0.678	0.000	1902	0.678	0.675	A0A2R8QPJ6.pdb.gz	A0A2R8QPJ6_DANRE Plexin-A2 OS=Danio rerio OX=7955 GN=plxna2 PE=1 SV=1
3	AFDB:B0S5N4	0.640	0.641	0.000	1892	0.619	0.619	B0S5N4.pdb.gz	PLXA3_DANRE Plexin A3 OS=Danio rerio OX=7955 GN=plxna3 PE=2 SV=2
4	AFDB:B2RXS4	0.513	0.526	0.000	1842	0.326	0.336	B2RXS4.pdb.gz	PLXB2_MOUSE Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 SV=1
5	AFDB:D3ZLH5	0.426	0.425	0.000	1902	0.336	0.334	D3ZLH5.pdb.gz	PLXB3_RAT Plexin-B3 OS=Rattus norvegicus OX=10116 GN=Plxnb3 PE=1 SV=1
6	AFDB:F1Q7U0	0.441	0.384	0.000	2220	0.350	0.298	F1Q7U0.pdb.gz	F1Q7U0_DANRE Plexin b1b OS=Danio rerio OX=7955 GN=plxnb1b PE=1 SV=1
7	AFDB:F1QBC0	0.515	0.523	0.000	1864	0.317	0.322	F1QBC0.pdb.gz	F1QBC0_DANRE Plexin b2a OS=Danio rerio OX=7955 GN=fk37b01 PE=1 SV=3
8	AFDB:O15031	0.522	0.536	0.000	1838	0.327	0.337	O15031.pdb.gz	PLXB2_HUMAN Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3
9	AFDB:O43157	0.412	0.372	0.000	2135	0.345	0.306	O43157.pdb.gz	PLXB1_HUMAN Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 SV=3
10	AFDB:O45657	0.345	0.364	0.000	1766	0.248	0.266	O45657.pdb.gz	PLX2_CAEEL Plexin-2 OS=Caenorhabditis elegans OX=6239 GN=plx-2 PE=1 SV=5
11	PDB:6vxkB	0.208	0.487	8.737E-25	747	0.074	0.189	6vxkB.pdb.gz
12	PDB:6qp7A	0.197	0.541	7.197E-18	620	0.053	0.161	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
13	PDB:3nvqA	0.203	0.580	3.159E-17	588	0.048	0.153	3nvqA.pdb.gz
14	PDB:3nvnA	0.156	0.644	7.722E-10	383	0.033	0.164	3nvnA.pdb.gz	Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
15	PDB:7sqcO0	0.066	0.095	1.771E-8	1140	0.040	0.066	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
16	PDB:5a42A	0.070	0.080	1.560E-7	1597	0.069	0.081	5a42A.pdb.gz
17	PDB:1e07A	0.055	0.114	1.939E-7	642	0.029	0.084	1e07A.pdb.gz
18	PDB:5e7gA	0.065	0.183	6.008E-7	446	0.026	0.112	5e7gA.pdb.gz	Molecular Dissection of Xyloglucan Recognition in a Prominent Human Gut Symbiont.
19	PDB:7q5zA	0.072	0.088	9.697E-7	1344	0.029	0.040	7q5zA.pdb.gz
20	PDB:7nxdA	0.137	0.248	1.498E-6	905	0.050	0.105	7nxdA.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A2R8QPJ6	2675	1902	0.677	0.675	A0A2R8QPJ6_DANRE Plexin-A2 OS=Danio rerio OX=7955 GN=plxna2 PE=1 SV=1
2	A8IYK2	2444	1885	0.634	0.637	A8IYK2_DANRE Plexin-A1 OS=Danio rerio OX=7955 GN=plxna1 PE=1 SV=1
3	B0S5N4	2433	1892	0.617	0.617	PLXA3_DANRE Plexin A3 OS=Danio rerio OX=7955 GN=plxna3 PE=2 SV=2
4	B2RXS4	927	1842	0.338	0.348	PLXB2_MOUSE Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 SV=1
5	C5H5I1	920	1864	0.341	0.346	C5H5I1_DANRE Plexin B2 OS=Danio rerio OX=7955 GN=plxnB2 PE=1 SV=1
6	D3ZLH5	952	1902	0.343	0.342	PLXB3_RAT Plexin-B3 OS=Rattus norvegicus OX=10116 GN=Plxnb3 PE=1 SV=1
7	F1Q7U0	804	2220	0.254	0.217	F1Q7U0_DANRE Plexin b1b OS=Danio rerio OX=7955 GN=plxnb1b PE=1 SV=1
8	F1QBC0	924	1864	0.340	0.345	F1QBC0_DANRE Plexin b2a OS=Danio rerio OX=7955 GN=fk37b01 PE=1 SV=3
9	H9XVP3	1367	1928	0.431	0.424	H9XVP3_DROME Plexin A, isoform F OS=Drosophila melanogaster OX=7227 GN=PlexA PE=1 SV=1
10	O15031	953	1838	0.336	0.347	PLXB2_HUMAN Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3
11	O43157	808	2135	0.254	0.226	PLXB1_HUMAN Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 SV=3
12	O75051	2649	1894	0.671	0.671	PLXA2_HUMAN Plexin-A2 OS=Homo sapiens OX=9606 GN=PLXNA2 PE=1 SV=4
13	O96681	1375	1945	0.435	0.424	O96681_DROME Plexin A OS=Drosophila melanogaster OX=7227 GN=PlexA PE=2 SV=1
14	P51805	2334	1871	0.592	0.600	PLXA3_HUMAN Plexin-A3 OS=Homo sapiens OX=9606 GN=PLXNA3 PE=1 SV=3
15	P70206	2462	1894	0.635	0.635	PLXA1_MOUSE Plexin-A1 OS=Mus musculus OX=10090 GN=Plxna1 PE=1 SV=1
16	P70207	2640	1894	0.667	0.667	PLXA2_MOUSE Plexin-A2 OS=Mus musculus OX=10090 GN=Plxna2 PE=1 SV=2
17	P70208	2343	1872	0.591	0.598	PLXA3_MOUSE Plexin-A3 OS=Mus musculus OX=10090 GN=Plxna3 PE=1 SV=2
18	Q0KIF1	1180	1505	0.361	0.454	Q0KIF1_DROME Plexin A, isoform B OS=Drosophila melanogaster OX=7227 GN=PlexA PE=1 SV=1
19	Q3UH93	891	1925	0.335	0.329	PLXD1_MOUSE Plexin-D1 OS=Mus musculus OX=10090 GN=Plxnd1 PE=1 SV=1
20	Q3V5K0	1073	1945	0.354	0.344	Q3V5K0_CAEEL Sema domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=plx-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08337 Plexin_cytopl	1.9e-199	674.7	Plexin cytoplasmic RasGAP domain
2	PF20170 Plexin_RBD	1.1e-43	159.4	Plexin cytoplasmic RhoGTPase-binding domain
3	PF01437 PSI	1.1e-16	72.4	Plexin repeat
4	PF17205 PSI_integrin	16	16.6	Integrin plexin domain
5	PF00616 RasGAP	12	17.2	GTPase-activator protein for Ras-like GTPase
6	PF01403 Sema	3.8e-19	80.8	Sema domain
7	PF01833 TIG	7.8e-38	139.8	IPT/TIG domain
8	PF18020 TIG_2	3.3e-29	112.7	TIG domain found in plexin
9	PF17960 TIG_plexin	1.1e-15	68.6	TIG domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352882

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000257414	0.998	Semaphorin-6A
2	9606.ENSP00000265362	0.996	Semaphorin-3A
3	9606.ENSP00000265371	0.994	Neuropilin-1
4	9606.ENSP00000246792	0.951	Ras-related protein R-Ras
5	9606.ENSP00000357909	0.930	Semaphorin-6C
6	9606.ENSP00000353582	0.926	Neuropilin-2
7	9606.ENSP00000484146	0.924	Semaphorin-3B
8	9606.ENSP00000336740	0.913	LIM domain kinase 1
9	9606.ENSP00000324806	0.912	Glycogen synthase kinase-3 beta
10	9606.ENSP00000308461	0.910	Rho-related GTP-binding protein Rho6
11	9606.ENSP00000356000	0.906	Plexin-A2
12	9606.ENSP00000377061	0.905	Plexin-A1
13	9606.ENSP00000231721	0.904	Semaphorin-3G
14	9606.ENSP00000358696	0.902	Plexin-A3
15	9606.ENSP00000361672	0.902	Forkhead box protein O6
16	9606.ENSP00000249071	0.895	Ras-related C3 botulinum toxin substrate 2
17	9606.ENSP00000304283	0.895	Ras-related C3 botulinum toxin substrate 3
18	9606.ENSP00000303212	0.889	Semaphorin-3E
19	9606.ENSP00000261918	0.886	Semaphorin-7A
20	9606.ENSP00000265361	0.886	Semaphorin-3C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0017154	1.000	semaphorin receptor activity
GO:0098772	0.456	molecular function regulator activity
GO:0140677	0.332	molecular function activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0009987	0.991	cellular process
GO:0048731	0.989	system development
GO:0050794	0.986	regulation of cellular process
GO:0009653	0.985	anatomical structure morphogenesis
GO:0048468	0.972	cell development
GO:0040012	0.960	regulation of locomotion
GO:0007399	0.932	nervous system development
GO:0071840	0.926	cellular component organization or biogenesis
GO:0000902	0.926	cell morphogenesis
GO:0016043	0.912	cellular component organization
GO:0023052	0.896	signaling
GO:0040011	0.883	locomotion
GO:0006935	0.874	chemotaxis
GO:0032989	0.850	cellular component morphogenesis
GO:0022008	0.831	neurogenesis
GO:0051716	0.809	cellular response to stimulus
GO:0048666	0.808	neuron development
GO:0007154	0.795	cell communication
GO:0007165	0.754	signal transduction
GO:0030030	0.727	cell projection organization
GO:0009888	0.724	tissue development
GO:0007166	0.718	cell surface receptor signaling pathway
GO:0120036	0.712	plasma membrane bounded cell projection organization
GO:0031175	0.690	neuron projection development
GO:0071526	0.689	semaphorin-plexin signaling pathway
GO:0016477	0.679	cell migration
GO:0048513	0.678	animal organ development
GO:0051128	0.670	regulation of cellular component organization
GO:0065008	0.626	regulation of biological quality
GO:0048518	0.620	positive regulation of biological process
GO:0060322	0.577	head development
GO:0007417	0.563	central nervous system development
GO:0048583	0.554	regulation of response to stimulus
GO:0048858	0.538	cell projection morphogenesis
GO:0048522	0.521	positive regulation of cellular process
GO:0048812	0.517	neuron projection morphogenesis
GO:0007420	0.515	brain development
GO:0061564	0.512	axon development
GO:0009790	0.500	embryo development
GO:0000904	0.500	cell morphogenesis involved in differentiation
GO:0048646	0.482	anatomical structure formation involved in morphogenesis
GO:0048667	0.464	cell morphogenesis involved in neuron differentiation
GO:0007409	0.450	axonogenesis
GO:0048519	0.415	negative regulation of biological process
GO:0051239	0.393	regulation of multicellular organismal process
GO:0048523	0.368	negative regulation of cellular process
GO:0120035	0.365	regulation of plasma membrane bounded cell projection organization
GO:0021675	0.354	nerve development
GO:0097485	0.344	neuron projection guidance
GO:0021545	0.342	cranial nerve development
GO:0021953	0.339	central nervous system neuron differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.957	protein-containing complex
GO:0043235	0.762	receptor complex
GO:0043226	0.433	organelle
GO:0002116	0.392	semaphorin receptor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]