StarFunc result for job id Q9HCM3

User Input

>input (1950 residues)
MPGARRRRRGAAMEGKPRAGVALAPGPSGRRPSARCARRRRPGLLLPGLWLLLLARPASC
APDELSPEQHNLSLYSMELVLKKSTGHSAAQVALTETAPGSQHSSPLHVTAPPSATTFDT
AFFNQGKQTKSTADPSIFVATYVSVTSKEVAVNDDEMDNFLPDTHWTTPRMVSPIQYITV
SPPGLPREALEPMLTPSLPMVSLQDEEVTSGWQNTTRQPAAYAESASHFHTFRSAFRTSE
GIVPTPGRNLVLYPTDAYSHLSSRTLPEIVASLTEGVETTLFLSSRSLMPQPLGDGITIP
LPSLGEVSQPPEEVWATSADRYTDVTTVLSQSLEETISPRTYPTVTASHAALAFSRTHSP
LLSTPLAFASSASPTDVSSNPFLPSDSSKTSELHSNSALPGPVDNTHILSPVSSFRPYTW
CAACTVPSPQQVLATSLMEKDVGSGDGAETLCMTVLEESSISLMSSVVADFSEFEEDPQV
FNTLFPSRPIVPLSSRSMEISETSVGISAEVDMSSVTTTQVPPAHGRLSVPASLDPTAGS
LSVAETQVTPSSVTTAFFSVITSILLDSSFSVIANKNTPSLAVRDPSVFTPYSLVPSVES
SLFSDQERSSFSEHKPRGALDFASSFFSTPPLELSGSISSPSEAPASLSLMPSDLSPFTS
QSFSPLVETFTLFDSSDLQSSQLSLPSSTNLEFSQLQPSSELPLNTIMLLPSRSEVSPWS
SFPSDSLEFVEASTVSLTDSEAHFTSAFIETTSYLESSLISHESAVTALVPPGSESFDIL
TAGIQATSPLTTVHTTPILTESSLFSTLTPPDDQISALDGHVSVLASFSKAIPTGTVLIT
DAYLPSGSSFVSEATPFPLPTELTVVGPSLTPTEVPLNTSTEVSTTSTGAATGGPLDSTL
MGDAASQSPPESSAAPPLPSLRPVTAFTLEATVDTPTLATAKPPYVCDITVPDAYLITTV
LARRAVQEYIITAIKEVLRIHFNRAVELKVYELFTDFTFLVTSGPFVYTAISVINVLINS
KLVRDQTPLILSVKPSFLVPESRFQVQTVLQFVPPSVDTGFCNFTQRIEKGLMTALFEVR
KHHQGTYNLTVQILNITISSSRVTPRRGPVNIIFAVKSTQGFLNGSEVSELLRNLSVVEF
SFYLGYPVLQIAEPFQYPQLNLSQLLKSSWVRTVLLGVMEKQLQNEVFQAEMERKLAQLL
SEVSTRRRMWRRATVAAGNSVVQVVNVSRLEGDDNPVQLIYFVEDQDGERLSAVKSSDLI
NKMDLQRAAIILGYRIQGVIAQPVDRVKRPSPESQSNNLWVIVGVVIPVLVVMVIVVILY
WKLCRTDKLDFQPDTVANIQQRQKLQIPSVKGFDFAKQHLGQHNKDDILIIHEPAPLPGP
LKDHTTPSENGDVPSPKSKIPSKNVRHRGRVSPSDADSTVSEESSERDAGDKTPGAVNDG
RSHRAPQSGPPLPSSGNEQHSSASIFEHVDRISRPPEASRRVPSKIQLIAMQPIPAPPVQ
RPSPADRVAESNKINKEIQTALRHKSEIEHHRNKIRLRAKRRGHYEFPVVDDLSSGDTKE
RHRVYRRAQMQIDKILDPTASVPSVFIEPRKSSRIKRSPKPRRKHQVNGCPADAEKDRLI
TTDSDGTYRRPPGVHNSAYIGCPSDPDLPADVQTPSSVELGRYPALPFPASQYIPPQPSI
EEARQTMHSLLDDAFALVAPSSQPASTAGVGPGVPPGLPANSTPSQEERRATQWGSFYSP
AQTANNPCSRYEDYGMTPPTGPLPRPGFGPGLLQSTELVPPDPQQPQASAEAPFAARGIY
SEEMPSVARPRPVGGTTGSQIQHLTQVGIASRIGAQPVEIPPSRGSQYGGPGWPSYGEDE
AGRREATHMLGHQEYSSSPLFQVPRTSGREPSAPSGNLPHRGLQGPGLGYPTSSTEDLQP
GHSSASLIKAIREELLRLSQKQSTVQNFHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q68FD9	0.307	0.309	0.000	1940	0.727	0.730	Q68FD9.pdb.gz	K1549_MOUSE UPF0606 protein KIAA1549 OS=Mus musculus OX=10090 GN=Kiaa1549 PE=1 SV=3
2	AFDB:Q9HCM3	1.000	1.000	0.000	1950	1.000	1.000	Q9HCM3.pdb.gz	K1549_HUMAN UPF0606 protein KIAA1549 OS=Homo sapiens OX=9606 GN=KIAA1549 PE=1 SV=4
3	AFDB:X2JEM2	0.044	0.039	1.659E-10	2326	0.146	0.123	X2JEM2.pdb.gz	X2JEM2_DROME Secretory 16, isoform I OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
4	AFDB:M9NFI9	0.033	0.031	2.325E-10	2148	0.137	0.124	M9NFI9.pdb.gz	M9NFI9_DROME Spinophilin, isoform J OS=Drosophila melanogaster OX=7227 GN=Spn PE=1 SV=1
5	AFDB:D4AC33	0.041	0.041	5.716E-10	1920	0.125	0.127	D4AC33.pdb.gz	D4AC33_RAT Methylcytosine dioxygenase TET OS=Rattus norvegicus OX=10116 GN=Tet2 PE=3 SV=2
6	AFDB:H2KYH3	0.041	0.035	9.480E-10	2476	0.131	0.103	H2KYH3.pdb.gz	RING2_CAEEL E3 ubiquitin-protein ligase RING2 homolog spat-3 OS=Caenorhabditis elegans OX=6239 GN=spat-3 PE=3 SV=1
7	AFDB:E9Q5F9	0.053	0.045	4.588E-8	2537	0.139	0.107	E9Q5F9.pdb.gz	SETD2_MOUSE Histone-lysine N-methyltransferase SETD2 OS=Mus musculus OX=10090 GN=Setd2 PE=1 SV=1
8	AFDB:Q4JK59	0.045	0.045	5.431E-8	1912	0.123	0.126	Q4JK59.pdb.gz	TET2_MOUSE Methylcytosine dioxygenase TET2 OS=Mus musculus OX=10090 GN=Tet2 PE=1 SV=3
9	AFDB:P48415	0.038	0.035	9.530E-8	2195	0.139	0.124	P48415.pdb.gz	SEC16_YEAST COPII coat assembly protein SEC16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC16 PE=1 SV=2
10	AFDB:Q8CGM2	0.032	0.033	1.581E-7	1859	0.136	0.143	Q8CGM2.pdb.gz	RP1L1_MOUSE Retinitis pigmentosa 1-like 1 protein OS=Mus musculus OX=10090 GN=Rp1l1 PE=1 SV=1
11	PDB:5vsuA	0.056	0.150	8.157E-6	387	0.025	0.127	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
12	PDB:5it0A	0.050	0.159	3.948E-4	396	0.014	0.071	5it0A.pdb.gz	SAD phasing using iodide ions in a high-throughput structural genomics environment.
13	PDB:6vz8F	0.033	0.231	4.187E-3	159	0.014	0.170	6vz8F.pdb.gz	Structures of fungal and plant acetohydroxyacid synthases.
14	PDB:2f1fA	0.035	0.234	4.685E-3	163	0.009	0.110	2f1fA.pdb.gz
15	PDB:2nqpA	0.037	0.185	7.347E-3	264	0.011	0.083	2nqpA.pdb.gz	How U38, 39, and 40 of Many tRNAs Become the Targets for Pseudouridylation by TruA.
16	PDB:6u9hG	0.033	0.259	1.442E-2	169	0.015	0.178	6u9hG.pdb.gz	Structures of fungal and plant acetohydroxyacid synthases.
17	PDB:2v9kA	0.042	0.128	1.806E-2	467	0.022	0.090	2v9kA.pdb.gz	Crystal Structure of Human Pus10, a Novel Pseudouridine Synthase.
18	PDB:3q08A	0.040	0.166	1.806E-2	241	0.017	0.137	3q08A.pdb.gz	Structural features promoting dioxygen production by Dechloromonas aromatica chlorite dismutase.
19	PDB:2apoA	0.034	0.124	2.021E-2	304	0.010	0.062	2apoA.pdb.gz	The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs.
20	PDB:1hr6D	0.037	0.098	2.138E-2	443	0.017	0.074	1hr6D.pdb.gz	Crystal structures of mitochondrial processing peptidase reveal the mode for specific cleavage of import signal sequences.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q68FD9	0.0	2532	1940	0.727	0.731	K1549_MOUSE UPF0606 protein KIAA1549 OS=Mus musculus OX=10090 GN=Kiaa1549 PE=1 SV=3
2	Q9HCM3	0.0	3930	1950	1.000	1.000	K1549_HUMAN UPF0606 protein KIAA1549 OS=Homo sapiens OX=9606 GN=KIAA1549 PE=1 SV=4
3	Q90747	3.4	34.7	335	0.011	0.066	Q90747_CHICK B6.2 OS=Gallus gallus OX=9031 PE=2 SV=1
4	Q90746	4.3	34.3	335	0.011	0.066	Q90746_CHICK B6.1 OS=Gallus gallus OX=9031 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12877 DUF3827	0	1010.9	Domain of unknown function (DUF3827)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000416040

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000251849	0.936	RAF proto-oncogene serine/threonine-protein kinase
2	9606.ENSP00000410603	0.931	Protein FAM131B
3	9606.ENSP00000290277	0.927	Serine/threonine-protein kinase A-Raf
4	9606.ENSP00000319060	0.902	Calcium/calmodulin-dependent protein kinase type II subunit gamma
5	9606.ENSP00000339740	0.902	Calcium/calmodulin-dependent protein kinase type II subunit delta
6	9606.ENSP00000379098	0.902	Calcium/calmodulin-dependent protein kinase type II subunit beta
7	9606.ENSP00000381412	0.902	Calcium/calmodulin-dependent protein kinase type II subunit alpha
8	9606.ENSP00000371067	0.900	Tyrosine-protein kinase JAK2
9	9606.ENSP00000288602	0.886	Serine/threonine-protein kinase B-raf
10	9606.ENSP00000234488	0.846	Chloride transport protein 6
11	9606.ENSP00000355094	0.793	Protein quaking
12	9606.ENSP00000381958	0.769	Kinase suppressor of Ras 1
13	9606.ENSP00000347581	0.756	Acylglycerol kinase, mitochondrial
14	9606.ENSP00000348573	0.743	A-kinase anchor protein 9
15	9606.ENSP00000350170	0.737	Fragile X mental retardation syndrome-related protein 1
16	9606.ENSP00000341597	0.733	Protein FAM114A2
17	9606.ENSP00000373347	0.712	SLIT-ROBO Rho GTPase-activating protein 3
18	9606.ENSP00000340507	0.706	Transcription intermediary factor 1-alpha
19	9606.ENSP00000302486	0.705	Dual specificity mitogen-activated protein kinase kinase 1
20	9606.ENSP00000265174	0.701	Bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.527	organic cyclic compound binding
GO:1901363	0.526	heterocyclic compound binding
GO:0003824	0.488	catalytic activity
GO:0046983	0.312	protein dimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050789	0.988	regulation of biological process
GO:0050794	0.941	regulation of cellular process
GO:0048518	0.851	positive regulation of biological process
GO:0019222	0.818	regulation of metabolic process
GO:0051171	0.809	regulation of nitrogen compound metabolic process
GO:0080090	0.801	regulation of primary metabolic process
GO:0060255	0.800	regulation of macromolecule metabolic process
GO:0008152	0.762	metabolic process
GO:0043170	0.671	macromolecule metabolic process
GO:0051246	0.635	regulation of protein metabolic process
GO:0071840	0.633	cellular component organization or biogenesis
GO:0016043	0.599	cellular component organization
GO:0065009	0.584	regulation of molecular function
GO:0044237	0.499	cellular metabolic process
GO:0044238	0.489	primary metabolic process
GO:0006807	0.485	nitrogen compound metabolic process
GO:0031323	0.476	regulation of cellular metabolic process
GO:0051336	0.470	regulation of hydrolase activity
GO:0009893	0.451	positive regulation of metabolic process
GO:0050896	0.448	response to stimulus
GO:0010604	0.440	positive regulation of macromolecule metabolic process
GO:0010646	0.410	regulation of cell communication
GO:0023051	0.396	regulation of signaling
GO:0032502	0.394	developmental process
GO:0044093	0.386	positive regulation of molecular function
GO:0048519	0.383	negative regulation of biological process
GO:0048583	0.371	regulation of response to stimulus
GO:0051247	0.369	positive regulation of protein metabolic process
GO:0043085	0.361	positive regulation of catalytic activity
GO:0032501	0.359	multicellular organismal process
GO:0048523	0.358	negative regulation of cellular process
GO:0009966	0.348	regulation of signal transduction
GO:0048522	0.338	positive regulation of cellular process
GO:0048856	0.329	anatomical structure development
GO:0006996	0.328	organelle organization
GO:0045862	0.311	positive regulation of proteolysis
GO:0051345	0.307	positive regulation of hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.997	membrane-bounded organelle
GO:0005886	0.997	plasma membrane
GO:0043229	0.951	intracellular organelle
GO:0043231	0.865	intracellular membrane-bounded organelle
GO:0005737	0.845	cytoplasm
GO:0005829	0.773	cytosol
GO:0042995	0.496	cell projection
GO:0012505	0.495	endomembrane system
GO:0043233	0.451	organelle lumen
GO:0070013	0.442	intracellular organelle lumen
GO:0120025	0.429	plasma membrane bounded cell projection
GO:0043005	0.374	neuron projection
GO:0043232	0.370	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]