StarFunc result for job id Q9HCM4

User Input

>input (733 residues)
MLSFFRRTLGRRSMRKHAEKERLREAQRAATHIPAAGDSKSIITCRVSLLDGTDVSVDLP
KKAKGQELFDQIMYHLDLIESDYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRV
KFYSSEPNNLREELTRYLFVLQLKQDILSGKLDCPFDTAVQLAAYNLQAELGDYDLAEHS
PELVSEFRFVPIQTEEMELAIFEKWKEYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKAR
DGNDYSLGLTPTGVLVFEGDTKIGLFFWPKITRLDFKKNKLTLVVVEDDDQGKEQEHTFV
FRLDHPKACKHLWKCAVEHHAFFRLRGPVQKSSHRSGFIRLGSRFRYSGKTEYQTTKTNK
ARRSTSFERRPSKRYSRRTLQMKACATKPEELSVHNNVSTQSNGSQQAWGMRSALPVSPS
ISSAPVPVEIENLPQSPGTDQHDRKCIPLNIDLLNSPDLLEATIGDVIGASDTMETSQAL
NDVNVATRLPGLGEPEVEYETLKDTSEKLKQLEMENSPLLSPRSNIDVNINSQEEVVKLT
EKCLNNVIESPGLNVMRVPPDFKSNILKAQVEAVHKVTKEDSLLSHKNANVQDAATNSAV
LNENNVPLPKESLETLMLITPADSGSVLKEATDELDALLASLTENLIDHTVAPQVSSTSM
ITPRWIVPQSGAMSNGLAGCEMLLTGKEGHGNKDGISLISPPAPFLVDAVTSSGPILAEE
AVLKQKCLLTTEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HCM4	1.000	1.000	0.000	733	1.000	1.000	Q9HCM4.pdb.gz	E41L5_HUMAN Band 4.1-like protein 5 OS=Homo sapiens OX=9606 GN=EPB41L5 PE=1 SV=3
2	AFDB:Q8BGS1	0.697	0.699	5.537E-99	731	0.839	0.841	Q8BGS1.pdb.gz	E41L5_MOUSE Band 4.1-like protein 5 OS=Mus musculus OX=10090 GN=Epb41l5 PE=1 SV=1
3	AFDB:Q58CU2	0.525	0.761	2.339E-76	502	0.580	0.847	Q58CU2.pdb.gz	E41L5_BOVIN Band 4.1-like protein 5 OS=Bos taurus OX=9913 GN=EPB41L5 PE=1 SV=1
4	AFDB:F6NJ58	0.550	0.516	1.094E-69	783	0.621	0.581	F6NJ58.pdb.gz
5	AFDB:Q9JMC8	0.474	0.658	1.247E-56	527	0.370	0.514	Q9JMC8.pdb.gz	E41LB_MOUSE Band 4.1-like protein 4B OS=Mus musculus OX=10090 GN=Epb41l4b PE=1 SV=2
6	AFDB:Q9H329	0.475	0.387	2.525E-56	900	0.452	0.368	Q9H329.pdb.gz	E41LB_HUMAN Band 4.1-like protein 4B OS=Homo sapiens OX=9606 GN=EPB41L4B PE=2 SV=2
7	AFDB:Q9VFU8	0.463	0.351	1.537E-51	972	0.398	0.300	Q9VFU8.pdb.gz	Q9VFU8_DROME Moesin/ezrin/radixin homolog 1 OS=Drosophila melanogaster OX=7227 GN=yrt PE=2 SV=1
8	AFDB:A0T1Z4	0.458	0.361	3.112E-51	932	0.396	0.311	A0T1Z4.pdb.gz	A0T1Z4_DROME Moesin/ezrin/radixin homolog 1 OS=Drosophila melanogaster OX=7227 GN=yrt PE=2 SV=1
9	AFDB:E9PHY5	0.440	0.347	2.946E-37	935	0.255	0.200	E9PHY5.pdb.gz	E9PHY5_HUMAN Erythrocyte membrane protein band 4.1 like 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
10	AFDB:G3V874	0.434	0.332	2.445E-36	963	0.254	0.193	G3V874.pdb.gz	G3V874_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=4 SV=1
11	PDB:4rm8A	0.357	0.694	1.605E-21	368	0.116	0.231	4rm8A.pdb.gz
12	PDB:6r9tA	0.189	0.071	3.148E-8	2185	0.055	0.018	6r9tA.pdb.gz
13	PDB:7c3mA	0.295	0.368	2.759E-7	577	0.071	0.090	7c3mA.pdb.gz
14	PDB:5itdA	0.100	0.075	3.761E-4	995	0.056	0.041	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
15	PDB:3pvuA	0.102	0.121	1.241E-3	609	0.063	0.076	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
16	PDB:6u3eA	0.119	0.188	1.542E-3	397	0.038	0.071	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
17	PDB:3dbhI	0.102	0.734	1.815E-3	86	0.019	0.163	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
18	PDB:3ljuX	0.107	0.205	2.381E-3	373	0.030	0.059	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
19	PDB:5dxhD	0.102	0.078	2.654E-3	981	0.038	0.029	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
20	PDB:2y3aA	0.103	0.079	3.481E-3	976	0.035	0.027	2y3aA.pdb.gz	Structure of Lipid Kinase P110Beta-P85Beta Elucidates an Unusual Sh2-Domain-Mediated Inhibitory Mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q58CU2	0.0	887	502	0.570	0.833	E41L5_BOVIN Band 4.1-like protein 5 OS=Bos taurus OX=9913 GN=EPB41L5 PE=1 SV=1
2	Q6NYK4	0.0	835	772	0.632	0.600	Q6NYK4_DANRE Band 4.1-like protein 5 OS=Danio rerio OX=7955 GN=dZ104F18.2 PE=1 SV=1
3	Q8BGS1	0.0	1245	731	0.839	0.841	E41L5_MOUSE Band 4.1-like protein 5 OS=Mus musculus OX=10090 GN=Epb41l5 PE=1 SV=1
4	Q9H329	0.0	601	900	0.464	0.378	E41LB_HUMAN Band 4.1-like protein 4B OS=Homo sapiens OX=9606 GN=EPB41L4B PE=2 SV=2
5	Q9HCM4	0.0	1523	733	1.000	1.000	E41L5_HUMAN Band 4.1-like protein 5 OS=Homo sapiens OX=9606 GN=EPB41L5 PE=1 SV=3
6	Q9JMC8	0.0	573	527	0.378	0.526	E41LB_MOUSE Band 4.1-like protein 4B OS=Mus musculus OX=10090 GN=Epb41l4b PE=1 SV=2
7	A0T1Z5	4.92e-172	514	786	0.318	0.296	A0T1Z5_DROME Moesin/ezrin/radixin homolog 1 OS=Drosophila melanogaster OX=7227 GN=yrt PE=2 SV=1
8	B7Z0J2	9.13e-172	518	919	0.318	0.254	B7Z0J2_DROME Moesin/ezrin/radixin homolog 1 OS=Drosophila melanogaster OX=7227 GN=yrt PE=4 SV=1
9	A0T1Z4	1.61e-171	518	932	0.318	0.250	A0T1Z4_DROME Moesin/ezrin/radixin homolog 1 OS=Drosophila melanogaster OX=7227 GN=yrt PE=2 SV=1
10	Q9VFU8	1.80e-171	519	972	0.318	0.240	Q9VFU8_DROME Moesin/ezrin/radixin homolog 1 OS=Drosophila melanogaster OX=7227 GN=yrt PE=2 SV=1
11	E9PII3	7.50e-91	301	706	0.209	0.217	E9PII3_HUMAN Erythrocyte membrane protein band 4.1 like 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
12	A0A2R8Y5B3	5.88e-90	301	824	0.209	0.186	A0A2R8Y5B3_HUMAN Erythrocyte membrane protein band 4.1 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
13	E9PK52	6.81e-90	301	811	0.209	0.189	E9PK52_HUMAN Erythrocyte membrane protein band 4.1 like 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
14	E9PHY5	1.11e-89	303	935	0.209	0.164	E9PHY5_HUMAN Erythrocyte membrane protein band 4.1 like 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
15	O43491	3.50e-89	303	1005	0.209	0.152	E41L2_HUMAN Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1
16	A8K968	3.50e-86	290	756	0.203	0.197	A8K968_HUMAN Erythrocyte membrane protein band 4.1 like 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=1
17	Q9WV92	9.03e-86	292	929	0.203	0.160	E41L3_MOUSE Band 4.1-like protein 3 OS=Mus musculus OX=10090 GN=Epb41l3 PE=1 SV=1
18	A0A8I5ZZJ7	1.97e-85	289	835	0.202	0.177	A0A8I5ZZJ7_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=1 SV=1
19	A3E0T0	2.26e-85	290	870	0.202	0.170	A3E0T0_RAT Erythrocyte protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=2 SV=1
20	A0A8I5ZVK0	2.89e-85	290	888	0.202	0.167	A0A8I5ZVK0_RAT Erythrocyte membrane protein band 4.1-like 3 OS=Rattus norvegicus OX=10116 GN=Epb41l3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00887 ACBP	2.3e+02	13.6	Acyl CoA binding protein
2	PF08736 FA	1.1e-09	49.5	FERM adjacent (FA)
3	PF09380 FERM_C	4e-17	73.7	FERM C-terminal PH-like domain
4	PF00373 FERM_M	1.3e-17	75.7	FERM central domain
5	PF09379 FERM_N	1.2e-16	71.7	FERM N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263713

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261681	0.883	MAGUK p55 subfamily member 5
2	9606.ENSP00000362734	0.816	Protein crumbs homolog 2
3	9606.ENSP00000356370	0.805	Protein crumbs homolog 1
4	9606.ENSP00000264638	0.796	Contactin-associated protein 1
5	9606.ENSP00000349204	0.769	Protein crumbs homolog 3
6	9606.ENSP00000453399	0.741	Transmembrane protein 185B
7	9606.ENSP00000337443	0.740	Nucleoredoxin
8	9606.ENSP00000261537	0.739	E3 ubiquitin-protein ligase MIB1
9	9606.ENSP00000367408	0.689	Peripheral plasma membrane protein CASK
10	9606.ENSP00000295797	0.688	Protein kinase C iota type
11	9606.ENSP00000265459	0.666	Neurexin-2
12	9606.ENSP00000385142	0.666	Neurexin-1
13	9606.ENSP00000451648	0.666	Neurexin-3
14	9606.ENSP00000305288	0.637	Neuroligin-2
15	9606.ENSP00000351591	0.637	Neuroligin-3
16	9606.ENSP00000370485	0.637	Neuroligin-4, X-linked
17	9606.ENSP00000392500	0.637	Neuroligin-1
18	9606.ENSP00000244221	0.633	Polyadenylate-binding protein-interacting protein 2B
19	9606.ENSP00000380690	0.625	BICD family-like cargo adapter 1
20	9606.ENSP00000281537	0.621	Tight junction protein ZO-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0009987	0.992	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0048518	0.981	positive regulation of biological process
GO:0032501	0.912	multicellular organismal process
GO:0048522	0.910	positive regulation of cellular process
GO:0032502	0.907	developmental process
GO:0048856	0.904	anatomical structure development
GO:0007275	0.890	multicellular organism development
GO:0048731	0.804	system development
GO:0009653	0.702	anatomical structure morphogenesis
GO:0048598	0.597	embryonic morphogenesis
GO:0007163	0.493	establishment or maintenance of cell polarity
GO:0048583	0.491	regulation of response to stimulus
GO:0023051	0.489	regulation of signaling
GO:0071840	0.487	cellular component organization or biogenesis
GO:0010646	0.483	regulation of cell communication
GO:0035088	0.464	establishment or maintenance of apical/basal cell polarity
GO:0016043	0.451	cellular component organization
GO:0045197	0.448	establishment or maintenance of epithelial cell apical/basal polarity
GO:0050896	0.423	response to stimulus
GO:0048513	0.423	animal organ development
GO:0009966	0.414	regulation of signal transduction
GO:0048519	0.399	negative regulation of biological process
GO:0007399	0.398	nervous system development
GO:0019222	0.391	regulation of metabolic process
GO:0048523	0.378	negative regulation of cellular process
GO:0060255	0.373	regulation of macromolecule metabolic process
GO:0023056	0.362	positive regulation of signaling
GO:0010647	0.347	positive regulation of cell communication
GO:0009967	0.341	positive regulation of signal transduction
GO:0001654	0.336	eye development
GO:0048592	0.301	eye morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.998	intracellular anatomical structure
GO:0005886	0.998	plasma membrane
GO:0043226	0.997	organelle
GO:0043229	0.993	intracellular organelle
GO:0043227	0.992	membrane-bounded organelle
GO:0043231	0.974	intracellular membrane-bounded organelle
GO:0005654	0.956	nucleoplasm
GO:0030054	0.949	cell junction
GO:0005829	0.947	cytosol
GO:0005911	0.636	cell-cell junction
GO:0032991	0.597	protein-containing complex
GO:0070160	0.334	tight junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]