StarFunc result for job id Q9HCM7

User Input

>input (1045 residues)
MEAKVRPSRRSRAQRDRGRRREAARDARAQSPSSGDEPEPSPGKENAGLRGAPPRGAAPA
PRTARPPRRRRRESSSQEEEVIDGFAIASFSTLEALEKDMALKPHERKEKWERRLIKKPR
ESETCPPAEPSENRRPLEAGSPGQDLEPACDGARKVPLQPSKQMKVTVSKGGDRDSDDDS
VLEATSSRDPLSDSSAHAVSGRGYSCDSESGPDDKASVGSEKLFAPGTDKGPALEKSEAK
AGPVPKVSGLERSRELSAESFLPTASPAPHAAPCPGPPPGSRANPLVKKEPPAPHRHTPQ
PPPPQPRGLLPTHVPASLGAFAGHSQAAANGLHGLSRSSSAPLGLGKHVSLSPHGPGPHL
STSHLALRSQAQHQLHAAMFAAPPTLPPPPALPASSLVLPGHPADHELLRQELNTRFLVQ
SAERPGASLGPGALLRAEFHQHQHTHQHTHQHTHQHQHTFAPFPAGLPPTPPAAPPPFDK
YAPKLDSPYFRHSSVSFFPSFPPAIPGLPTLLPHPGPFGSLQGAFQPKVSDPYRAVVKVS
TCWEGPWQGRTLVPPGRPRGARDSRSLQKTWVGVAPAPLSASILSQKPGRWCAVHVQIAW
QIYRHQQKIKEMQLDPHKLEVGAKLDLFGRPPAPGVFAGFHYPQDLARPLFPSTGAAHPA
SNPFGPSAHPGSFLPTGPLTDPFSRPSTFGGLGSLSSHAFGGLGSHALAPGGSIFAPKEG
SSVHGLPSPHEAWNRLHRAPPSFPAPPPWPKSVDAERVSALTNHDREPDNGKEEQERDLL
EKTRLLSRASPATPAGHPVSGLLLRAQSELGRSGAPAEREAEPRVKESRSPAKEEAAKMP
ARASPPHSKAAPGDVKVKEERGEDEASEPPAGGLHPAPLQLGLGRERLGAPGFAWEPFRG
LELPRRAFPAAAPAPGSAALLEPPERPYRDREPHGYSPERLRGELERARAPHLPPAAPAL
DGALLPSLGALHFPRLSPAALHNGLLARTPPAAAALGAPPPLVTAAGPPTPPGPPRSRTT
PLGGLGPGEARDYSPSRNPPEVEAR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HCM7	0.999	0.999	0.000	1045	1.000	1.000	Q9HCM7.pdb.gz	FBSL_HUMAN Fibrosin-1-like protein OS=Homo sapiens OX=9606 GN=FBRSL1 PE=1 SV=4
2	AFDB:A0A087WPF7	0.079	0.068	1.625E-34	1261	0.434	0.360	A0A087WPF7.pdb.gz	AUTS2_MOUSE Autism susceptibility gene 2 protein homolog OS=Mus musculus OX=10090 GN=Auts2 PE=1 SV=2
3	AFDB:P29617	0.040	0.029	4.405E-4	1703	0.193	0.119	P29617.pdb.gz	PROS_DROME Homeobox protein prospero OS=Drosophila melanogaster OX=7227 GN=pros PE=1 SV=3
4	AFDB:F4K9W2	0.039	0.036	1.585E-3	1154	0.131	0.119	F4K9W2.pdb.gz	F4K9W2_ARATH Spectrin beta chain, brain OS=Arabidopsis thaliana OX=3702 GN=MWD9.25 PE=1 SV=1
5	AFDB:Q8CHH5	0.040	0.039	5.705E-3	1074	0.175	0.170	Q8CHH5.pdb.gz	BICRL_MOUSE BRD4-interacting chromatin-remodeling complex-associated protein-like OS=Mus musculus OX=10090 GN=Bicral PE=1 SV=2
6	AFDB:Q5JTC6	0.047	0.045	7.062E-3	1135	0.170	0.157	Q5JTC6.pdb.gz	AMER1_HUMAN APC membrane recruitment protein 1 OS=Homo sapiens OX=9606 GN=AMER1 PE=1 SV=2
7	AFDB:Q6AI39	0.045	0.044	1.008E-2	1079	0.161	0.156	Q6AI39.pdb.gz	BICRL_HUMAN BRD4-interacting chromatin-remodeling complex-associated protein-like OS=Homo sapiens OX=9606 GN=BICRAL PE=1 SV=2
8	AFDB:Q9HCH0	0.040	0.034	1.248E-2	1334	0.220	0.172	Q9HCH0.pdb.gz	NCK5L_HUMAN Nck-associated protein 5-like OS=Homo sapiens OX=9606 GN=NCKAP5L PE=1 SV=4
9	AFDB:Q9W0B0	0.049	0.046	1.340E-2	1107	0.136	0.128	Q9W0B0.pdb.gz	Q9W0B0_DROME Serine-arginine repetitive matrix 2/3/4, isoform C OS=Drosophila melanogaster OX=7227 GN=Srrm234 PE=1 SV=2
10	AFDB:Q5VWG9	0.042	0.047	2.053E-2	929	0.144	0.163	Q5VWG9.pdb.gz	TAF3_HUMAN Transcription initiation factor TFIID subunit 3 OS=Homo sapiens OX=9606 GN=TAF3 PE=1 SV=1
11	PDB:7odrd	0.020	0.062	4.214	259	0.009	0.035	7odrd.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
12	PDB:6n7pA	0.024	0.098	4.858	186	0.012	0.070	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
13	PDB:7d4iRJ	0.019	0.026	7.444	738	0.014	0.020	7d4iRJ.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
14	PDB:7pubFh	0.023	0.080	7.444	274	0.012	0.047	7pubFh.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
15	PDB:7w5a2	0.021	0.159	9.215	123	0.010	0.081	7w5a2.pdb.gz	Mechanism of exon ligation by human spliceosome.
16	PDB:7d63RJ	0.021	0.026	9.895	796	0.015	0.020	7d63RJ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state C)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HCM7	0.0	2025	1045	1.000	1.000	FBSL_HUMAN Fibrosin-1-like protein OS=Homo sapiens OX=9606 GN=FBRSL1 PE=1 SV=4
2	Q8WXX7	1.22e-85	303	1259	0.317	0.263	AUTS2_HUMAN Autism susceptibility gene 2 protein OS=Homo sapiens OX=9606 GN=AUTS2 PE=1 SV=1
3	A0A1X9RK87	2.74e-85	303	1277	0.326	0.267	A0A1X9RK87_DANRE Activator of transcription and developmental regulator AUTS2 a OS=Danio rerio OX=7955 GN=auts2a PE=2 SV=1
4	F1QRM5	8.27e-79	282	1126	0.278	0.258	F1QRM5_DANRE Activator of transcription and developmental regulator AUTS2 a OS=Danio rerio OX=7955 GN=auts2a PE=4 SV=3
5	A0A2R8RIS2	1.89e-74	265	810	0.202	0.260	A0A2R8RIS2_DANRE Activator of transcription and developmental regulator AUTS2 a OS=Danio rerio OX=7955 GN=auts2a PE=4 SV=1
6	A0A087WPF7	2.55e-72	264	1261	0.206	0.170	AUTS2_MOUSE Autism susceptibility gene 2 protein homolog OS=Mus musculus OX=10090 GN=Auts2 PE=1 SV=2
7	E7F4D0	4.32e-67	248	1278	0.201	0.164	E7F4D0_DANRE Activator of transcription and developmental regulator AUTS2 a OS=Danio rerio OX=7955 GN=auts2a PE=2 SV=3
8	A0A1X9RK86	4.71e-67	248	1277	0.201	0.164	A0A1X9RK86_DANRE Activator of transcription and developmental regulator AUTS2 a OS=Danio rerio OX=7955 GN=auts2a PE=2 SV=1
9	A0A1X9RK91	1.82e-66	242	811	0.200	0.258	A0A1X9RK91_DANRE Activator of transcription and developmental regulator AUTS2 a OS=Danio rerio OX=7955 GN=auts2a PE=2 SV=1
10	Q8R089	1.62e-33	137	466	0.135	0.303	FBRS_MOUSE Probable fibrosin-1 OS=Mus musculus OX=10090 GN=Fbrs PE=1 SV=2
11	Q9VXM5	0.003	44.3	2486	0.014	0.006	Q9VXM5_DROME LD22609p OS=Drosophila melanogaster OX=7227 GN=tay PE=2 SV=3
12	X2JC54	0.003	44.3	2485	0.014	0.006	X2JC54_DROME Tay bridge, isoform D OS=Drosophila melanogaster OX=7227 GN=tay PE=4 SV=1
13	Q9JJ50	2.8	34.3	776	0.025	0.034	HGS_RAT Hepatocyte growth factor-regulated tyrosine kinase substrate OS=Rattus norvegicus OX=10116 GN=Hgs PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15336 Auts2	1.5e-86	301.6	Autism susceptibility gene 2 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000396160

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419494	0.910	RING1 and YY1-binding protein
2	9606.ENSP00000262506	0.845	Casein kinase II subunit alpha
3	9606.ENSP00000328004	0.794	YY1 associated factor 2, isoform CRA_d
4	9606.ENSP00000332110	0.788	Olfactory receptor 4N5
5	9606.ENSP00000483345	0.717	Hepatoma-derived growth factor-related protein 2
6	9606.ENSP00000483236	0.680	DDB1- and CUL4-associated factor 7
7	9606.ENSP00000273075	0.647	Aspartyl aminopeptidase
8	9606.ENSP00000364515	0.635	BTB/POZ domain-containing protein 17
9	9606.ENSP00000354794	0.578	Zinc finger protein 521
10	9606.ENSP00000254627	0.576	Otoconin 90
11	9606.ENSP00000262283	0.576	Otoconin-90
12	9606.ENSP00000354724	0.567	Polycomb group RING finger protein 3
13	9606.ENSP00000409964	0.567	Cilia and flagella associated protein 97
14	9606.ENSP00000331044	0.554	Enkurin
15	9606.ENSP00000445704	0.546	Polycomb group RING finger protein 5
16	9606.ENSP00000316845	0.542	Rho guanine nucleotide exchange factor 4
17	9606.ENSP00000263847	0.511	Oxysterol-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.545	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.992	regulation of biological process
GO:0050794	0.981	regulation of cellular process
GO:0009987	0.964	cellular process
GO:0048518	0.838	positive regulation of biological process
GO:0080090	0.804	regulation of primary metabolic process
GO:0060255	0.777	regulation of macromolecule metabolic process
GO:0048522	0.725	positive regulation of cellular process
GO:0051171	0.722	regulation of nitrogen compound metabolic process
GO:0031323	0.646	regulation of cellular metabolic process
GO:0019219	0.503	regulation of nucleobase-containing compound metabolic process
GO:0048856	0.419	anatomical structure development
GO:0032501	0.375	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0005634	0.989	nucleus
GO:0070013	0.968	intracellular organelle lumen
GO:0031981	0.954	nuclear lumen
GO:0005654	0.905	nucleoplasm
GO:0005737	0.650	cytoplasm
GO:0032991	0.383	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]