StarFunc result for job id Q9HCM9

User Input

>input (518 residues)
MAETSLLEAGASAASTAAALENLQVEASCSVCLEYLKEPVIIECGHNFCKACITRWWEDL
ERDFPCPVCRKTSRYRSLRPNRQLGSMVEIAKQLQAVKRKIRDESLCPQHHEALSLFCYE
DQEAVCLICAISHTHRAHTVVPLDDATQEYKEKLQKCLEPLEQKLQEITRCKSSEEKKPG
ELKRLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKRRDL
AHLAAEVEGKCLQSGFEMLKDVKSTLEKNIPRKFGGSLSTICPRDHKALLGLVKEINRCE
KVKTMEVTSVSIELEKNFSNFPRQYFALRKILKQLIADVTLDPETAHPNLVLSEDRKSVK
FVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEVEVGDKTHWAVGVCRDSVSRKGEL
TPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKRVGIFLDYEAGTLSFYNVTDRSHI
YTFTDTFTEKLWPLFYPGIRAGRKNAAPLTIRPPTDWE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RCP5	0.603	0.603	5.794E-87	518	1.000	1.000	A0A024RCP5.pdb.gz	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
2	AFDB:A0A024RCR1	0.767	0.808	3.565E-83	488	0.934	0.992	A0A024RCR1.pdb.gz
3	AFDB:A0A096LP39	0.443	0.453	1.162E-50	503	0.697	0.718	A0A096LP39.pdb.gz	A0A096LP39_HUMAN Ribonuclease P protein subunit p21 OS=Homo sapiens OX=9606 GN=TRIM39-RPP21 PE=1 SV=1
4	AFDB:Q495X7	0.459	0.499	1.249E-47	471	0.396	0.435	Q495X7.pdb.gz	TRI60_HUMAN Tripartite motif-containing protein 60 OS=Homo sapiens OX=9606 GN=TRIM60 PE=1 SV=2
5	AFDB:A0A1U9X8R9	0.369	0.372	4.072E-47	513	0.376	0.380	A0A1U9X8R9.pdb.gz	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
6	AFDB:Q5NCC9	0.396	0.418	2.623E-45	485	0.371	0.396	Q5NCC9.pdb.gz	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
7	AFDB:Q62191	0.431	0.465	2.936E-45	470	0.347	0.383	Q62191.pdb.gz	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
8	AFDB:A6NK02	0.508	0.554	4.115E-45	468	0.398	0.440	A6NK02.pdb.gz	TRI75_HUMAN Tripartite motif-containing protein 75 OS=Homo sapiens OX=9606 GN=TRIM75 PE=3 SV=2
9	AFDB:P19474	0.424	0.454	1.199E-44	475	0.376	0.411	P19474.pdb.gz	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
10	AFDB:Q96F44	0.377	0.411	3.911E-44	468	0.392	0.434	Q96F44.pdb.gz	TRI11_HUMAN E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=2
11	PDB:7y4sA	0.346	0.514	6.534E-23	343	0.178	0.268	7y4sA.pdb.gz
12	PDB:4b3nA	0.307	0.286	1.052E-17	557	0.129	0.120	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
13	PDB:7ccbA	0.247	0.713	2.179E-7	164	0.052	0.165	7ccbA.pdb.gz
14	PDB:4tn3B	0.243	0.324	6.003E-7	362	0.112	0.160	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
15	PDB:7z36B	0.217	0.246	1.248E-6	446	0.106	0.123	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
16	PDB:6swy1	0.220	0.211	5.097E-6	542	0.075	0.072	6swy1.pdb.gz
17	PDB:7nsba	0.217	0.200	1.485E-5	568	0.073	0.067	7nsba.pdb.gz
18	PDB:7nscA	0.256	0.451	1.662E-5	276	0.054	0.101	7nscA.pdb.gz
19	PDB:5t15B	0.184	0.025	1.341E-3	4170	0.039	0.005	5t15B.pdb.gz	Structural Basis for Gating and Activation of RyR1.
20	PDB:3ipvA	0.205	0.364	2.104E-3	249	0.041	0.084	3ipvA.pdb.gz	X-ray structure of a galactose-specific lectin from Spatholobous parviflorous

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024RCP5	0.0	1069	518	1.000	1.000	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
2	A0A096LP39	0.0	707	503	0.710	0.732	A0A096LP39_HUMAN Ribonuclease P protein subunit p21 OS=Homo sapiens OX=9606 GN=TRIM39-RPP21 PE=1 SV=1
3	A2AAZ6	0.0	526	260	0.502	1.000	A2AAZ6_HUMAN E3 ubiquitin-protein ligase TRIM39 (Fragment) OS=Homo sapiens OX=9606 GN=TRIM39 PE=4 SV=8
4	Q9HCM9	0.0	1069	518	1.000	1.000	TRI39_HUMAN E3 ubiquitin-protein ligase TRIM39 OS=Homo sapiens OX=9606 GN=TRIM39 PE=1 SV=2
5	H0Y735	2.40e-138	400	227	0.402	0.916	H0Y735_HUMAN E3 ubiquitin-protein ligase TRIM39 (Fragment) OS=Homo sapiens OX=9606 GN=TRIM39 PE=4 SV=1
6	Q495X7	1.95e-126	379	471	0.392	0.431	TRI60_HUMAN Tripartite motif-containing protein 60 OS=Homo sapiens OX=9606 GN=TRIM60 PE=1 SV=2
7	A6NK02	4.97e-125	375	468	0.390	0.432	TRI75_HUMAN Tripartite motif-containing protein 75 OS=Homo sapiens OX=9606 GN=TRIM75 PE=3 SV=2
8	A0A1U9X8R9	7.44e-114	348	513	0.375	0.378	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
9	P14373	7.44e-114	348	513	0.375	0.378	TRI27_HUMAN Zinc finger protein RFP OS=Homo sapiens OX=9606 GN=TRIM27 PE=1 SV=1
10	Q62158	7.47e-113	345	513	0.373	0.376	TRI27_MOUSE Zinc finger protein RFP OS=Mus musculus OX=10090 GN=Trim27 PE=1 SV=2
11	P19474	1.36e-111	341	475	0.378	0.413	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
12	Q96F44	1.46e-110	338	468	0.398	0.440	TRI11_HUMAN E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=2
13	Q5NCC9	2.20e-106	328	485	0.365	0.390	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
14	Q99PQ2	5.20e-105	324	467	0.388	0.430	TRI11_MOUSE E3 ubiquitin-protein ligase TRIM11 OS=Mus musculus OX=10090 GN=Trim11 PE=1 SV=1
15	Q6AZZ1	7.37e-101	314	485	0.357	0.381	TRI68_HUMAN E3 ubiquitin-protein ligase TRIM68 OS=Homo sapiens OX=9606 GN=TRIM68 PE=1 SV=1
16	A2AAZ5	1.43e-100	301	144	0.278	1.000	A2AAZ5_HUMAN E3 ubiquitin-protein ligase TRIM39 (Fragment) OS=Homo sapiens OX=9606 GN=TRIM39 PE=4 SV=1
17	O00635	1.67e-100	312	465	0.373	0.415	TRI38_HUMAN E3 ubiquitin-protein ligase TRIM38 OS=Homo sapiens OX=9606 GN=TRIM38 PE=1 SV=1
18	Q923T7	8.95e-100	312	510	0.361	0.367	TRIM7_MOUSE E3 ubiquitin-protein ligase TRIM7 OS=Mus musculus OX=10090 GN=Trim7 PE=2 SV=2
19	Q62191	2.44e-99	309	470	0.353	0.389	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
20	Q3U7K7	6.22e-99	308	462	0.353	0.396	Q3U7K7_MOUSE RING-type E3 ubiquitin transferase OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05290 Baculo_IE-1	48	15.3	Baculovirus immediate-early protein (IE-0)
2	PF02601 Exonuc_VII_L	81	14.2	Exonuclease VII, large subunit
3	PF10359 Fmp27_WPPW	7.7e+02	10.3	RNA pol II promoter Fmp27 protein domain
4	PF14447 Prok-RING_4	0.13	23.4	Prokaryotic RING finger family 4
5	PF13765 PRY	5.9e-18	75.5	SPRY-associated domain
6	PF00622 SPRY	9.3e-18	75.9	SPRY domain
7	PF14992 TMCO5	3.6e+02	12.1	TMCO5 family
8	PF04564 U-box	48	15.5	U-box domain
9	PF12861 zf-ANAPC11	2.5	19.6	Anaphase-promoting complex subunit 11 RING-H2 finger
10	PF00643 zf-B_box	0.00018	32.9	B-box zinc finger
11	PF00097 zf-C3HC4	5.9e-09	47.0	Zinc finger, C3HC4 type (RING finger)
12	PF13923 zf-C3HC4_2	2.6e-06	38.4	Zinc finger, C3HC4 type (RING finger)
13	PF13920 zf-C3HC4_3	6.5e-06	37.2	Zinc finger, C3HC4 type (RING finger)
14	PF15227 zf-C3HC4_4	1.5e-11	55.6	zinc finger of C3HC4-type, RING
15	PF11789 zf-Nse	6.5	18.1	Zinc-finger of the MIZ type in Nse subunit
16	PF12678 zf-rbx1	0.21	23.2	RING-H2 zinc finger domain
17	PF16685 zf-RING_10	0.32	22.5	zinc RING finger of MSL2
18	PF13639 zf-RING_2	5.7e-05	34.7	Ring finger domain
19	PF14634 zf-RING_5	0.0031	28.8	zinc-RING finger domain
20	PF14835 zf-RING_6	0.002	29.3	zf-RING of BARD1-type protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365844

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000409799	0.815	Ribonuclease P protein subunit p21
2	9606.ENSP00000485378	0.804	Ribonuclease P protein subunit p21
3	9606.ENSP00000363019	0.772	Ubiquitin-conjugating enzyme E2 D1
4	9606.ENSP00000263182	0.745	Gamma-butyrobetaine dioxygenase
5	9606.ENSP00000363092	0.732	cGMP-dependent protein kinase 1
6	9606.ENSP00000377900	0.704	Lipase F, gastric type
7	9606.ENSP00000355658	0.696	E3 ubiquitin-protein ligase TRIM17
8	9606.ENSP00000451594	0.680	Modulator of apoptosis 1
9	9606.ENSP00000349274	0.665	Protein phosphatase 1 regulatory subunit 26
10	9606.ENSP00000359698	0.643	Ubiquitin domain-containing protein 1
11	9606.ENSP00000295756	0.620	T-cell receptor-associated transmembrane adapter 1
12	9606.ENSP00000301281	0.613	UBX domain-containing protein 6
13	9606.ENSP00000336931	0.610	Proline-rich nuclear receptor coactivator 1
14	9606.ENSP00000363641	0.559	Thioredoxin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.997	identical protein binding
GO:0003824	0.988	catalytic activity
GO:0004842	0.969	ubiquitin-protein transferase activity
GO:0061659	0.300	ubiquitin-like protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0048519	0.985	negative regulation of biological process
GO:0050896	0.982	response to stimulus
GO:0009987	0.977	cellular process
GO:0006950	0.955	response to stress
GO:0048583	0.946	regulation of response to stimulus
GO:0048518	0.932	positive regulation of biological process
GO:0060255	0.922	regulation of macromolecule metabolic process
GO:0031323	0.915	regulation of cellular metabolic process
GO:0048523	0.903	negative regulation of cellular process
GO:0080090	0.902	regulation of primary metabolic process
GO:1901987	0.901	regulation of cell cycle phase transition
GO:0051171	0.900	regulation of nitrogen compound metabolic process
GO:0045930	0.892	negative regulation of mitotic cell cycle
GO:1901990	0.875	regulation of mitotic cell cycle phase transition
GO:1901988	0.866	negative regulation of cell cycle phase transition
GO:0006974	0.859	cellular response to DNA damage stimulus
GO:0031324	0.842	negative regulation of cellular metabolic process
GO:1902749	0.837	regulation of cell cycle G2/M phase transition
GO:0051246	0.837	regulation of protein metabolic process
GO:0045861	0.834	negative regulation of proteolysis
GO:0009895	0.821	negative regulation of catabolic process
GO:0042770	0.816	signal transduction in response to DNA damage
GO:0044774	0.816	mitotic DNA integrity checkpoint signaling
GO:0071704	0.809	organic substance metabolic process
GO:1901991	0.791	negative regulation of mitotic cell cycle phase transition
GO:1903051	0.788	negative regulation of proteolysis involved in protein catabolic process
GO:0044773	0.786	mitotic DNA damage checkpoint signaling
GO:2000058	0.765	regulation of ubiquitin-dependent protein catabolic process
GO:0009966	0.736	regulation of signal transduction
GO:0010389	0.736	regulation of G2/M transition of mitotic cell cycle
GO:0006807	0.735	nitrogen compound metabolic process
GO:0010972	0.731	negative regulation of G2/M transition of mitotic cell cycle
GO:0042177	0.723	negative regulation of protein catabolic process
GO:0044238	0.704	primary metabolic process
GO:0061136	0.668	regulation of proteasomal protein catabolic process
GO:0007095	0.629	mitotic G2 DNA damage checkpoint signaling
GO:0032434	0.620	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0043170	0.613	macromolecule metabolic process
GO:0048522	0.560	positive regulation of cellular process
GO:0065008	0.549	regulation of biological quality
GO:0031330	0.537	negative regulation of cellular catabolic process
GO:0044237	0.531	cellular metabolic process
GO:1901564	0.531	organonitrogen compound metabolic process
GO:2000059	0.525	negative regulation of ubiquitin-dependent protein catabolic process
GO:0031647	0.507	regulation of protein stability
GO:0019538	0.493	protein metabolic process
GO:0043122	0.483	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0036211	0.385	protein modification process
GO:0048585	0.352	negative regulation of response to stimulus
GO:0010468	0.303	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	0.880	nucleus
GO:0070013	0.684	intracellular organelle lumen
GO:0031981	0.674	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.969	Transferases.

[back to server]