StarFunc result for job id Q9HCP0

User Input

>input (422 residues)
MDHPSREKDERQRTTKPMAQRSAHCSRPSGSSSSSGVLMVGPNFRVGKKIGCGNFGELRL
GKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSAGEGLPQVYYFGPCGKYNAMVLEL
LGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKE
HVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHM
FMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEALCENFPEEMATYLRYVRRLDFFE
KPDYEYLRTLFTDLFEKKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRP
SQQQPLRNQVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAKCCCFFKRKRKKTAQR
HK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IXA3	0.770	0.742	5.381E-70	438	0.962	0.927	Q8IXA3.pdb.gz	Q8IXA3_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=CSNK1G1 PE=1 SV=2
2	AFDB:Q3LS18	0.773	0.711	1.984E-67	460	0.896	0.822	Q3LS18.pdb.gz	Q3LS18_XENTR non-specific serine/threonine protein kinase OS=Xenopus tropicalis OX=8364 GN=csnk1g1 PE=2 SV=1
3	AFDB:P78368	0.801	0.814	1.499E-64	415	0.789	0.802	P78368.pdb.gz	KC1G2_HUMAN Casein kinase I isoform gamma-2 OS=Homo sapiens OX=9606 GN=CSNK1G2 PE=1 SV=1
4	AFDB:Q62763	0.760	0.717	4.782E-64	448	0.815	0.768	Q62763.pdb.gz	KC1G3_RAT Casein kinase I isoform gamma-3 OS=Rattus norvegicus OX=10116 GN=Csnk1g3 PE=1 SV=1
5	AFDB:Q4AB31	0.744	0.662	1.256E-55	476	0.697	0.618	Q4AB31.pdb.gz	Q4AB31_DROME Gilgamesh, isoform G OS=Drosophila melanogaster OX=7227 GN=gish PE=1 SV=1
6	AFDB:A0A0B4K7C4	0.747	0.640	5.464E-53	496	0.694	0.591	A0A0B4K7C4.pdb.gz	A0A0B4K7C4_DROME Gilgamesh, isoform K OS=Drosophila melanogaster OX=7227 GN=gish PE=1 SV=1
7	AFDB:Q8WQ99	0.742	0.769	8.499E-53	407	0.614	0.636	Q8WQ99.pdb.gz	KC1G_CAEEL Casein kinase I gamma OS=Caenorhabditis elegans OX=6239 GN=csnk-1 PE=1 SV=1
8	AFDB:A0A0B4K697	0.747	0.609	8.182E-52	521	0.685	0.555	A0A0B4K697.pdb.gz	A0A0B4K697_DROME Gilgamesh, isoform J OS=Drosophila melanogaster OX=7227 GN=gish PE=1 SV=1
9	AFDB:Q0VC49	0.678	0.614	5.495E-43	466	0.448	0.406	Q0VC49.pdb.gz	Q0VC49_BOVIN Casein kinase 1, epsilon OS=Bos taurus OX=9913 GN=CSNK1E PE=2 SV=1
10	AFDB:Q9JJ75	0.677	0.777	5.807E-43	367	0.422	0.485	Q9JJ75.pdb.gz	Q9JJ75_RAT Casein kinase 1 epsilon-3 OS=Rattus norvegicus OX=10116 GN=Csnk1e PE=2 SV=1
11	PDB:6gzdA	0.678	0.960	4.962E-39	297	0.382	0.542	6gzdA.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
12	PDB:6pxnA	0.661	0.953	1.388E-36	290	0.398	0.579	6pxnA.pdb.gz
13	PDB:2rsvA	0.565	0.589	1.955E-16	403	0.235	0.246	2rsvA.pdb.gz
14	PDB:1unlA	0.498	0.698	3.515E-14	292	0.140	0.202	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
15	PDB:4krcA	0.466	0.648	3.926E-14	297	0.133	0.189	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
16	PDB:5y86A	0.425	0.452	5.779E-14	395	0.116	0.124	5y86A.pdb.gz	Crystal Structure of Human Dual-Specificity Tyrosine-Regulated Kinase 3 Reveals New Structural Features and Insights into its Auto-phosphorylation
17	PDB:5u6yA	0.463	0.429	1.562E-13	459	0.130	0.120	5u6yA.pdb.gz
18	PDB:4c0tA	0.478	0.671	1.843E-13	291	0.149	0.216	4c0tA.pdb.gz
19	PDB:4mk0A	0.468	0.323	2.175E-13	631	0.171	0.114	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
20	PDB:4zhxA	0.501	0.515	2.299E-13	409	0.140	0.144	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4K697	535	521	0.661	0.536	A0A0B4K697_DROME Gilgamesh, isoform J OS=Drosophila melanogaster OX=7227 GN=gish PE=1 SV=1
2	A0A0B4K7C4	545	496	0.661	0.562	A0A0B4K7C4_DROME Gilgamesh, isoform K OS=Drosophila melanogaster OX=7227 GN=gish PE=1 SV=1
3	A0A0B4KHL4	559	537	0.661	0.520	A0A0B4KHL4_DROME Gilgamesh, isoform L OS=Drosophila melanogaster OX=7227 GN=gish PE=1 SV=1
4	A0A0U1RQT7	875	430	0.998	0.979	A0A0U1RQT7_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=CSNK1G1 PE=1 SV=1
5	P78368	696	415	0.791	0.805	KC1G2_HUMAN Casein kinase I isoform gamma-2 OS=Homo sapiens OX=9606 GN=CSNK1G2 PE=1 SV=1
6	Q3LS18	766	460	0.896	0.822	Q3LS18_XENTR non-specific serine/threonine protein kinase OS=Xenopus tropicalis OX=8364 GN=csnk1g1 PE=2 SV=1
7	Q4AB31	557	476	0.661	0.586	Q4AB31_DROME Gilgamesh, isoform G OS=Drosophila melanogaster OX=7227 GN=gish PE=1 SV=1
8	Q59DW8	581	463	0.673	0.613	Q59DW8_DROME Gilgamesh, isoform E OS=Drosophila melanogaster OX=7227 GN=gish PE=1 SV=1
9	Q62761	753	390	0.865	0.936	KC1G1_RAT Casein kinase I isoform gamma-1 OS=Rattus norvegicus OX=10116 GN=Csnk1g1 PE=2 SV=1
10	Q62762	691	415	0.789	0.802	KC1G2_RAT Casein kinase I isoform gamma-2 OS=Rattus norvegicus OX=10116 GN=Csnk1g2 PE=1 SV=2
11	Q62763	686	448	0.813	0.766	KC1G3_RAT Casein kinase I isoform gamma-3 OS=Rattus norvegicus OX=10116 GN=Csnk1g3 PE=1 SV=1
12	Q6NRT0	759	460	0.891	0.817	KC1G1_XENLA Casein kinase I isoform gamma-1 OS=Xenopus laevis OX=8355 GN=csnk1g1 PE=1 SV=1
13	Q86BR9	557	468	0.661	0.596	Q86BR9_DROME Gilgamesh, isoform B OS=Drosophila melanogaster OX=7227 GN=gish PE=1 SV=2
14	Q86NK8	558	474	0.661	0.589	Q86NK8_DROME Gilgamesh, isoform I OS=Drosophila melanogaster OX=7227 GN=gish PE=1 SV=1
15	Q8IHB0	509	358	0.569	0.670	Q8IHB0_DROME AT18609p OS=Drosophila melanogaster OX=7227 GN=gish PE=1 SV=1
16	Q8INB6	555	427	0.661	0.653	Q8INB6_DROME Gilgamesh, isoform C OS=Drosophila melanogaster OX=7227 GN=gish PE=1 SV=2
17	Q8IXA3	853	438	0.967	0.932	Q8IXA3_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=CSNK1G1 PE=1 SV=2
18	Q8WQ99	532	407	0.614	0.636	KC1G_CAEEL Casein kinase I gamma OS=Caenorhabditis elegans OX=6239 GN=csnk-1 PE=1 SV=1
19	Q9HCP0	884	422	1.000	1.000	KC1G1_HUMAN Casein kinase I isoform gamma-1 OS=Homo sapiens OX=9606 GN=CSNK1G1 PE=1 SV=1
20	Q9VEX2	578	422	0.673	0.673	Q9VEX2_DROME Gilgamesh, isoform A OS=Drosophila melanogaster OX=7227 GN=gish PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12605 CK1gamma_C	7.4e-09	47.9	Casein kinase 1 gamma C terminal
2	PF00069 Pkinase	1e-22	92.3	Protein kinase domain
3	PF17667 Pkinase_fungal	0.00014	32.4	Fungal protein kinase
4	PF07714 PK_Tyr_Ser-Thr	2.2e-10	51.9	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000015108

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000004278	0.738	Low-density lipoprotein receptor-related protein
2	61853.ENSNLEP00000009823	0.738	Axin 1
3	61853.ENSNLEP00000006160	0.731	Glycogen synthase kinase 3 beta
4	61853.ENSNLEP00000012897	0.731	annotation not available
5	61853.ENSNLEP00000009812	0.716	Dishevelled segment polarity protein 2
6	61853.ENSNLEP00000000031	0.715	Dishevelled segment polarity protein 1
7	61853.ENSNLEP00000007444	0.711	Dishevelled segment polarity protein 3
8	61853.ENSNLEP00000006304	0.689	Collagen, type IV, alpha 3 (Goodpasture antigen) binding protein
9	61853.ENSNLEP00000011861	0.678	Cellular tumor antigen p53
10	61853.ENSNLEP00000008691	0.665	Frizzled class receptor 5
11	61853.ENSNLEP00000000849	0.651	Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon
12	61853.ENSNLEP00000003935	0.651	Uncharacterized protein
13	61853.ENSNLEP00000008089	0.651	Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta
14	61853.ENSNLEP00000022474	0.651	Stratifin
15	61853.ENSNLEP00000022573	0.651	Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, gamma
16	61853.ENSNLEP00000001150	0.643	GLI family zinc finger 2
17	61853.ENSNLEP00000017164	0.632	Protein Wnt
18	61853.ENSNLEP00000001356	0.630	Forkhead box O1
19	61853.ENSNLEP00000007969	0.613	Low density lipoprotein receptor-related protein 5
20	61853.ENSNLEP00000018040	0.569	Axin 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0005515	0.998	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.987	primary metabolic process
GO:0006807	0.978	nitrogen compound metabolic process
GO:0043412	0.975	macromolecule modification
GO:0016310	0.975	phosphorylation
GO:0036211	0.974	protein modification process
GO:0065007	0.948	biological regulation
GO:0006468	0.942	protein phosphorylation
GO:0050789	0.933	regulation of biological process
GO:0050794	0.911	regulation of cellular process
GO:0018209	0.879	peptidyl-serine modification
GO:0050896	0.873	response to stimulus
GO:0018105	0.843	peptidyl-serine phosphorylation
GO:0051716	0.732	cellular response to stimulus
GO:0023052	0.692	signaling
GO:0007165	0.675	signal transduction
GO:0019222	0.426	regulation of metabolic process
GO:0051171	0.354	regulation of nitrogen compound metabolic process
GO:0060255	0.351	regulation of macromolecule metabolic process
GO:0048523	0.328	negative regulation of cellular process
GO:0080090	0.302	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016020	0.880	membrane
GO:0043226	0.455	organelle
GO:0043229	0.430	intracellular organelle
GO:0043227	0.425	membrane-bounded organelle
GO:0043231	0.421	intracellular membrane-bounded organelle
GO:0071944	0.348	cell periphery
GO:0005886	0.325	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]