StarFunc result for job id Q9HCP6

User Input

>input (504 residues)
MGIKTALPAAELGLYSLVLSGALAYAGRGLLEASQDGAHRKAFRESVRPGWEYIGRKMDV
ADFEWVMWFTSFRNVIIFALSGHVLFAKLCTMVAPKLRSWMYAVYGALAVMGTMGPWYLL
LLLGHCVGLYVASLLGQPWLCLGLGLASLASFKMDPLISWQSGFVTGTFDLQEVLFHGGS
SFTVLRCTSFALESCAHPDRHYSLADLLKYNFYLPFFFFGPIMTFDRFHAQVSQVEPVRR
EGELWHIRAQAGLSVVAIMAVDIFFHFFYILTIPSDLKFANRLPDSALAGLAYSNLVYDW
VKAAVLFGVVNTVACLDHLDPPQPPKCITALYVFAETHFDRGINDWLCKYVYNHIGGEHS
AVIPELAATVATFAITTLWLGPCDIVYLWSFLNCFGLNFELWMQKLAEWGPLARIEASLS
VQMSRRVRALFGAMNFWAIIMYNLVSLNSLKFTELVARRLLLTGFPQTTLSILFVTYCGV
QLVKERERTLALEEEQKQDKEKPE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HCP6	1.000	1.000	3.127E-65	504	1.000	1.000	Q9HCP6.pdb.gz	HHATL_HUMAN Protein-cysteine N-palmitoyltransferase HHAT-like protein OS=Homo sapiens OX=9606 GN=HHATL PE=1 SV=1
2	AFDB:Q8BMT9	0.912	0.921	9.555E-24	499	0.260	0.263	Q8BMT9.pdb.gz	HHAT_MOUSE Protein-cysteine N-palmitoyltransferase HHAT OS=Mus musculus OX=10090 GN=Hhat PE=1 SV=1
3	AFDB:Q5VTY9	0.910	0.930	1.266E-23	493	0.258	0.264	Q5VTY9.pdb.gz	HHAT_HUMAN Protein-cysteine N-palmitoyltransferase HHAT OS=Homo sapiens OX=9606 GN=HHAT PE=1 SV=1
4	PDB:7mhyA	0.902	0.925	5.175E-23	491	0.258	0.265	7mhyA.pdb.gz	Substrate and product complexes reveal mechanisms of Hedgehog acylation by HHAT.
5	AFDB:Q9VZU2	0.854	0.860	6.485E-18	500	0.198	0.200	Q9VZU2.pdb.gz	HHAT_DROME Protein-cysteine N-palmitoyltransferase Rasp OS=Drosophila melanogaster OX=7227 GN=rasp PE=1 SV=1
6	AFDB:Q09758	0.807	0.704	1.460E-14	583	0.200	0.173	Q09758.pdb.gz	GUP1_SCHPO Membrane-bound O-acyltransferase gup1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gup1 PE=3 SV=4
7	AFDB:P53154	0.775	0.703	2.435E-13	560	0.200	0.180	P53154.pdb.gz	GUP1_YEAST Membrane-bound O-acyltransferase GUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GUP1 PE=1 SV=1
8	AFDB:Q4WHK8	0.786	0.639	5.441E-13	629	0.218	0.175	Q4WHK8.pdb.gz	Q4WHK8_ASPFU Glycerol:H+ symporter (Gup1), putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_2G05040 PE=4 SV=1
9	AFDB:Q08929	0.810	0.677	5.664E-13	609	0.181	0.149	Q08929.pdb.gz	GUP2_YEAST Membrane-bound O-acyltransferase GUP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GUP2 PE=2 SV=1
10	AFDB:Q5AKZ2	0.781	0.681	1.677E-12	584	0.210	0.182	Q5AKZ2.pdb.gz	GUP1_CANAL Membrane-bound O-acyltransferase GUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GUP1 PE=3 SV=1
11	AFDB:Q387S3	0.763	0.639	2.797E-11	609	0.167	0.138	Q387S3.pdb.gz	Q387S3_TRYB2 Glycerol uptake protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.0380 PE=4 SV=1
12	PDB:7uraA	0.515	0.587	5.463E-6	432	0.119	0.139	7uraA.pdb.gz	Mechanisms and inhibition of Porcupine-mediated Wnt acylation.
13	PDB:7jm7A	0.129	0.108	2.223E-1	683	0.137	0.101	7jm7A.pdb.gz	Cryo-EM structure of the lysosomal chloride-proton exchanger CLC-7 in complex with OSTM1.
14	PDB:7n6qA	0.289	0.363	2.508E-1	375	0.115	0.155	7n6qA.pdb.gz	Structure of PPPA bound human ACAT2
15	PDB:4pb1A	0.108	0.127	4.229E-1	404	0.131	0.163	4pb1A.pdb.gz	Structural basis of nucleoside and nucleoside drug selectivity by concentrative nucleoside transporters.
16	PDB:1w07B	0.106	0.088	4.771E-1	658	0.109	0.084	1w07B.pdb.gz	Acyl-Coa Oxidase 1 from Arabidopsis Thaliana. Structure of a Key Enzyme in Plant Lipid Metabolism
17	PDB:7qe7J	0.108	0.107	8.721E-1	510	0.123	0.122	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
18	PDB:6fmrA	0.118	0.122	1.110	475	0.129	0.137	6fmrA.pdb.gz	In situ serial crystallography for rapid de novo membrane protein structure determination.
19	PDB:4gbyA	0.099	0.103	1.155	475	0.093	0.099	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
20	PDB:5oxpA	0.117	0.122	1.203	462	0.139	0.152	5oxpA.pdb.gz	Multispecific Substrate Recognition in a Proton-Dependent Oligopeptide Transporter.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9D1G3	0.0	945	503	0.909	0.911	HHATL_MOUSE Protein-cysteine N-palmitoyltransferase HHAT-like protein OS=Mus musculus OX=10090 GN=Hhatl PE=1 SV=2
2	Q9HCP6	0.0	1037	504	1.000	1.000	HHATL_HUMAN Protein-cysteine N-palmitoyltransferase HHAT-like protein OS=Homo sapiens OX=9606 GN=HHATL PE=1 SV=1
3	Q5VTY9	1.53e-41	157	493	0.264	0.270	HHAT_HUMAN Protein-cysteine N-palmitoyltransferase HHAT OS=Homo sapiens OX=9606 GN=HHAT PE=1 SV=1
4	Q8BMT9	4.24e-41	156	499	0.246	0.248	HHAT_MOUSE Protein-cysteine N-palmitoyltransferase HHAT OS=Mus musculus OX=10090 GN=Hhat PE=1 SV=1
5	Q9VZU2	1.75e-16	84.3	500	0.159	0.160	HHAT_DROME Protein-cysteine N-palmitoyltransferase Rasp OS=Drosophila melanogaster OX=7227 GN=rasp PE=1 SV=1
6	P53154	2.51e-11	68.2	560	0.101	0.091	GUP1_YEAST Membrane-bound O-acyltransferase GUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GUP1 PE=1 SV=1
7	Q09758	2.90e-11	68.2	583	0.187	0.161	GUP1_SCHPO Membrane-bound O-acyltransferase gup1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gup1 PE=3 SV=4
8	Q5AKZ2	1.35e-09	62.8	584	0.187	0.161	GUP1_CANAL Membrane-bound O-acyltransferase GUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GUP1 PE=3 SV=1
9	Q4WHK8	1.19e-07	56.6	629	0.111	0.089	Q4WHK8_ASPFU Glycerol:H+ symporter (Gup1), putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_2G05040 PE=4 SV=1
10	Q08929	1.60e-05	50.1	609	0.091	0.076	GUP2_YEAST Membrane-bound O-acyltransferase GUP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GUP2 PE=2 SV=1
11	Q387S3	3.81e-05	48.5	609	0.081	0.067	Q387S3_TRYB2 Glycerol uptake protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.0380 PE=4 SV=1
12	Q51392	0.012	40.8	520	0.127	0.123	ALGI_PSEAE Probable alginate O-acetylase AlgI OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=algI PE=3 SV=2
13	Q6VQA2	1.2	34.3	1114	0.032	0.014	Q6VQA2_DANRE Pro-epidermal growth factor OS=Danio rerio OX=7955 GN=egf PE=2 SV=1
14	P43527	2.7	33.1	402	0.026	0.032	CASP1_RAT Caspase-1 OS=Rattus norvegicus OX=10116 GN=Casp1 PE=2 SV=1
15	Q03602	4.6	32.3	844	0.044	0.026	PTR9_CAEEL Patched-related protein 9 OS=Caenorhabditis elegans OX=6239 GN=ptr-9 PE=3 SV=2
16	P29452	5.0	32.0	402	0.026	0.032	CASP1_MOUSE Caspase-1 OS=Mus musculus OX=10090 GN=Casp1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03062 MBOAT	6.3e-08	44.0	MBOAT, membrane-bound O-acyltransferase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000405423

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000205214	0.775	Acyl-CoA synthetase family member 4
2	9606.ENSP00000458770	0.691	Acyl carrier protein, mitochondrial
3	9606.ENSP00000245615	0.672	Lysophospholipid acyltransferase 7
4	9606.ENSP00000356015	0.642	Acetyl-CoA acetyltransferase, cytosolic
5	9606.ENSP00000362376	0.636	Uncharacterized protein FAM241B
6	9606.ENSP00000268154	0.629	Zinc finger protein 710
7	9606.ENSP00000400908	0.575	Myosin-binding protein C, slow-type
8	9606.ENSP00000372654	0.570	Aquaporin-4
9	9606.ENSP00000302177	0.551	Lysophospholipid acyltransferase 2
10	9606.ENSP00000391137	0.543	Ankyrin repeat and SOCS box protein 10
11	9606.ENSP00000265838	0.540	Acetyl-CoA acetyltransferase, mitochondrial
12	9606.ENSP00000304586	0.538	Ankyrin repeat and sterile alpha motif domain containing 3
13	9606.ENSP00000261407	0.525	Lysophospholipid acyltransferase 5
14	9606.ENSP00000321679	0.525	Ankyrin repeat domain-containing protein 23
15	9606.ENSP00000360214	0.522	Opalin
16	9606.ENSP00000255039	0.521	Hyaluronan and proteoglycan link protein 2
17	9606.ENSP00000402790	0.521	Transmembrane protein 235
18	9606.ENSP00000309117	0.511	RNA binding protein fox-1 homolog 1
19	9606.ENSP00000324204	0.507	Maturin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.636	catalytic activity
GO:0016740	0.603	transferase activity
GO:0016747	0.512	acyltransferase activity, transferring groups other than amino-acyl groups
GO:0008374	0.315	O-acyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0080090	0.985	regulation of primary metabolic process
GO:2000112	0.983	regulation of cellular macromolecule biosynthetic process
GO:0051246	0.976	regulation of protein metabolic process
GO:0048519	0.963	negative regulation of biological process
GO:0009987	0.828	cellular process
GO:0051172	0.680	negative regulation of nitrogen compound metabolic process
GO:0031399	0.633	regulation of protein modification process
GO:0051248	0.610	negative regulation of protein metabolic process
GO:0009890	0.597	negative regulation of biosynthetic process
GO:0031324	0.595	negative regulation of cellular metabolic process
GO:0031327	0.591	negative regulation of cellular biosynthetic process
GO:0008152	0.505	metabolic process
GO:0071704	0.461	organic substance metabolic process
GO:0044238	0.446	primary metabolic process
GO:0010558	0.419	negative regulation of macromolecule biosynthetic process
GO:0031400	0.383	negative regulation of protein modification process
GO:0044237	0.368	cellular metabolic process
GO:2000113	0.361	negative regulation of cellular macromolecule biosynthetic process
GO:0006807	0.337	nitrogen compound metabolic process
GO:1901564	0.305	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0012505	0.997	endomembrane system
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0016020	0.902	membrane
GO:0005783	0.695	endoplasmic reticulum
GO:0048471	0.435	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.603	Transferases.
EC:2.3.1.-	0.512	Transferring groups other than amino-acyl groups.

[back to server]