StarFunc result for job id Q9HCR9

User Input

>input (933 residues)
MAASRLDFGEVETFLDRHPELFEDYLMRKGKQEMVEKWLQRHSQGQGALGPRPSLAGTSS
LAHSTCRGGSSVGGGTGPNGSAHSQPLPGGGDCGGVPLSPSWAGGSRGDGNLQRRASQKE
LRKSFARSKAIHVNRTYDEQVTSRAQEPLSSVRRRALLRKASSLPPTTAHILSALLESRV
NLPRYPPTAIDYKCHLKKHNERQFFLELVKDISNDLDLTSLSYKILIFVCLMVDADRCSL
FLVEGAAAGKKTLVSKFFDVHAGTPLLPCSSTENSNEVQVPWGKGIIGYVGEHGETVNIP
DAYQDRRFNDEIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKIPEGAPFTEDDEKVMQ
MYLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKC
ERCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVA
STGLPVNISDAYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFD
DADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDVLSYHATCSKAEVDKFKAANI
PLVSELAIDDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNYRM
VLYHNWRHAFNVCQLMFAMLTTAGFQDILTEVEILAVIVGCLCHDLDHRGTNNAFQAKSG
SALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLTLY
FERRTEFFELVSKGEYDWNIKNHRDIFRSMLMTACDLGAVTKPWEISRQVAELVTSEFFE
QGDRERLELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNVKLKPMLDSVAT
NRSKWEELHQKRLLASTASSSPASVMVAKEDRN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8VID6	0.814	0.812	0.000	935	0.944	0.942	Q8VID6.pdb.gz	PDE11_RAT Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Rattus norvegicus OX=10116 GN=Pde11a PE=1 SV=1
2	AFDB:O76074	0.703	0.748	5.161E-65	875	0.372	0.397	O76074.pdb.gz	PDE5A_HUMAN cGMP-specific 3',5'-cyclic phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE5A PE=1 SV=2
3	AFDB:Q9QYJ6	0.636	0.739	6.580E-48	794	0.249	0.292	Q9QYJ6.pdb.gz	PDE10_RAT cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A OS=Rattus norvegicus OX=10116 GN=Pde10a PE=1 SV=1
4	PDB:7jsnA	0.544	0.607	1.503E-47	820	0.273	0.311	7jsnA.pdb.gz	Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6.
5	AFDB:B3VTJ2	0.364	0.361	7.179E-47	941	0.250	0.248	B3VTJ2.pdb.gz	B3VTJ2_MACMU Phosphodiesterase OS=Macaca mulatta OX=9544 GN=PDE2A3 PE=2 SV=1
6	PDB:6mzbB	0.550	0.623	8.077E-47	807	0.277	0.320	6mzbB.pdb.gz	Cryo-EM structure of phosphodiesterase 6 reveals insights into the allosteric regulation of type I phosphodiesterases.
7	AFDB:P91119	0.502	0.637	1.387E-42	728	0.232	0.297	P91119.pdb.gz	PDE5_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-5 OS=Caenorhabditis elegans OX=6239 GN=pde-5 PE=3 SV=3
8	PDB:3bjcA	0.320	0.937	1.901E-24	311	0.155	0.466	3bjcA.pdb.gz	An insight into the pharmacophores of phosphodiesterase-5 inhibitors from synthetic and crystal structural studies
9	AFDB:O70628	0.341	0.587	2.397E-21	534	0.109	0.191	O70628.pdb.gz	PDE9A_MOUSE High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A OS=Mus musculus OX=10090 GN=Pde9a PE=1 SV=1
10	AFDB:Q23917	0.322	0.378	2.191E-20	793	0.109	0.129	Q23917.pdb.gz	PDE2_DICDI 3',5'-cyclic-nucleotide phosphodiesterase regA OS=Dictyostelium discoideum OX=44689 GN=regA PE=1 SV=1
11	PDB:4y86B	0.330	0.931	7.454E-20	326	0.098	0.279	4y86B.pdb.gz	Structural Asymmetry of Phosphodiesterase-9A and a Unique Pocket for Selective Binding of a Potent Enantiomeric Inhibitor.
12	AFDB:A0A0S2Z4T6	0.331	0.516	1.916E-19	593	0.108	0.170	A0A0S2Z4T6.pdb.gz	A0A0S2Z4T6_HUMAN Phosphodiesterase (Fragment) OS=Homo sapiens OX=9606 GN=PDE9A PE=2 SV=1
13	AFDB:Q13946	0.329	0.623	2.284E-18	482	0.101	0.195	Q13946.pdb.gz	PDE7A_HUMAN High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A OS=Homo sapiens OX=9606 GN=PDE7A PE=1 SV=2
14	AFDB:Q57V52	0.314	0.431	3.402E-18	676	0.125	0.173	Q57V52.pdb.gz	Q57V52_TRYB2 Phosphodiesterase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.420 PE=3 SV=1
15	PDB:1f5mB	0.152	0.684	7.636E-5	177	0.030	0.158	1f5mB.pdb.gz
16	PDB:1vhmB	0.141	0.695	2.309E-4	160	0.030	0.175	1vhmB.pdb.gz
17	PDB:7rzwB	0.233	0.249	5.352E-4	864	0.042	0.045	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
18	PDB:4zmuA	0.132	0.323	8.332E-4	341	0.039	0.106	4zmuA.pdb.gz
19	PDB:5loeA	0.143	0.438	1.239E-2	258	0.030	0.109	5loeA.pdb.gz	Structure of the Branched-chain Amino Acid and GTP-sensing Global Regulator, CodY, from Bacillus subtilis.
20	PDB:2q0oA	0.133	0.420	2.407E-2	235	0.035	0.140	2q0oA.pdb.gz	Structural basis for antiactivation in bacterial quorum sensing.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O54735	0.0	616	833	0.342	0.383	PDE5A_RAT cGMP-specific 3',5'-cyclic phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde5a PE=2 SV=1
2	O76074	0.0	617	875	0.348	0.371	PDE5A_HUMAN cGMP-specific 3',5'-cyclic phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE5A PE=1 SV=2
3	Q8CG03	0.0	609	865	0.343	0.370	PDE5A_MOUSE cGMP-specific 3',5'-cyclic phosphodiesterase OS=Mus musculus OX=10090 GN=Pde5a PE=1 SV=2
4	Q8VID6	0.0	1803	935	0.934	0.932	PDE11_RAT Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Rattus norvegicus OX=10116 GN=Pde11a PE=1 SV=1
5	Q9HCR9	0.0	1948	933	1.000	1.000	PDE11_HUMAN Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Homo sapiens OX=9606 GN=PDE11A PE=1 SV=2
6	Q9VFI9	0.0	666	1118	0.383	0.319	PDE6_DROME cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=Pde6 PE=1 SV=4
7	Q9VJ79	0.0	712	1451	0.383	0.246	PDE11_DROME Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 OS=Drosophila melanogaster OX=7227 GN=Pde11 PE=1 SV=4
8	P16499	5.52e-139	438	860	0.266	0.288	PDE6A_HUMAN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha OS=Homo sapiens OX=9606 GN=PDE6A PE=1 SV=4
9	P11541	2.12e-138	436	859	0.271	0.295	PDE6A_BOVIN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha OS=Bos taurus OX=9913 GN=PDE6A PE=1 SV=3
10	P23440	2.18e-138	436	856	0.274	0.299	PDE6B_MOUSE Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta OS=Mus musculus OX=10090 GN=Pde6b PE=2 SV=3
11	P35913	2.30e-138	436	854	0.274	0.300	PDE6B_HUMAN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta OS=Homo sapiens OX=9606 GN=PDE6B PE=1 SV=2
12	P27664	2.88e-138	436	859	0.264	0.286	PDE6A_MOUSE Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha OS=Mus musculus OX=10090 GN=Pde6a PE=2 SV=3
13	D3ZDI8	1.10e-137	434	856	0.272	0.297	D3ZDI8_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde6b PE=3 SV=1
14	Q6P4P8	4.28e-137	432	852	0.273	0.299	Q6P4P8_DANRE Phosphodiesterase OS=Danio rerio OX=7955 GN=zgc:73085 PE=1 SV=1
15	P23439	4.57e-136	430	853	0.272	0.298	PDE6B_BOVIN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta OS=Bos taurus OX=9913 GN=PDE6B PE=1 SV=1
16	P51160	5.47e-135	427	858	0.271	0.295	PDE6C_HUMAN Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' OS=Homo sapiens OX=9606 GN=PDE6C PE=1 SV=2
17	Q91ZQ1	7.05e-133	422	861	0.279	0.302	PDE6C_MOUSE Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' OS=Mus musculus OX=10090 GN=Pde6c PE=2 SV=1
18	Q9Y233	1.09e-115	374	779	0.230	0.276	PDE10_HUMAN cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A OS=Homo sapiens OX=9606 GN=PDE10A PE=1 SV=1
19	Q8CA95	1.20e-113	369	790	0.227	0.268	PDE10_MOUSE cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A OS=Mus musculus OX=10090 GN=Pde10a PE=1 SV=2
20	Q9QYJ6	1.43e-113	369	794	0.221	0.259	PDE10_RAT cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A OS=Rattus norvegicus OX=10116 GN=Pde10a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01590 GAF	7.3e-34	128.7	GAF domain
2	PF13185 GAF_2	5.3e-11	54.4	GAF domain
3	PF13492 GAF_3	1.8e-06	39.8	GAF domain
4	PF01966 HD	1.3e+02	14.3	HD domain
5	PF00233 PDEase_I	2.9e-76	267.8	3'5'-cyclic nucleotide phosphodiesterase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000286063

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386181	0.918	Tetratricopeptide repeat protein 30B
2	9606.ENSP00000485525	0.914	Adenylosuccinate lyase
3	9606.ENSP00000286621	0.906	Adenosine kinase
4	9606.ENSP00000286648	0.903	Deoxycytidine kinase
5	9606.ENSP00000371230	0.902	GTP:AMP phosphotransferase AK3, mitochondrial
6	9606.ENSP00000367615	0.900	Adenine phosphoribosyltransferase
7	9606.ENSP00000359719	0.821	cAMP-dependent protein kinase catalytic subunit beta
8	9606.ENSP00000376475	0.819	cAMP-dependent protein kinase type I-alpha regulatory subunit
9	9606.ENSP00000309591	0.809	cAMP-dependent protein kinase catalytic subunit alpha
10	9606.ENSP00000366488	0.794	cAMP-dependent protein kinase catalytic subunit gamma
11	9606.ENSP00000282249	0.793	Guanylate cyclase soluble subunit alpha-2
12	9606.ENSP00000264424	0.782	Guanylate cyclase soluble subunit beta-1
13	9606.ENSP00000356825	0.775	Adenylate cyclase type 10
14	9606.ENSP00000296518	0.772	Guanylate cyclase 1, soluble, alpha 3
15	9606.ENSP00000294016	0.770	Adenylate cyclase type 9
16	9606.ENSP00000286355	0.765	Adenylate cyclase type 8
17	9606.ENSP00000419361	0.760	Adenylate cyclase type 5
18	9606.ENSP00000264917	0.754	High affinity cAMP-specific and IBMX-insensitive 3',5'-cyclic phosphodiesterase 8B
19	9606.ENSP00000260600	0.751	Adenylate cyclase type 3
20	9606.ENSP00000261170	0.750	Heat-stable enterotoxin receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004114	0.998	3',5'-cyclic-nucleotide phosphodiesterase activity
GO:0005488	0.997	binding
GO:0000166	0.958	nucleotide binding
GO:0043167	0.956	ion binding
GO:0097367	0.940	carbohydrate derivative binding
GO:0043168	0.901	anion binding
GO:0032555	0.898	purine ribonucleotide binding
GO:0030551	0.862	cyclic nucleotide binding
GO:0032561	0.856	guanyl ribonucleotide binding
GO:0005515	0.804	protein binding
GO:0030553	0.765	cGMP binding
GO:0047555	0.523	3',5'-cyclic-GMP phosphodiesterase activity
GO:0004115	0.326	3',5'-cyclic-AMP phosphodiesterase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0050896	0.912	response to stimulus
GO:0007154	0.758	cell communication
GO:0023052	0.687	signaling
GO:0051716	0.668	cellular response to stimulus
GO:0007165	0.618	signal transduction
GO:0071704	0.521	organic substance metabolic process
GO:0044237	0.452	cellular metabolic process
GO:0044238	0.438	primary metabolic process
GO:0006807	0.429	nitrogen compound metabolic process
GO:0006753	0.350	nucleoside phosphate metabolic process
GO:1901564	0.311	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043226	0.785	organelle
GO:0043229	0.567	intracellular organelle
GO:0043227	0.547	membrane-bounded organelle
GO:0036477	0.324	somatodendritic compartment
GO:0016020	0.312	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14653	0.998	a nucleoside 3',5'-cyclic phosphate + H2O = a nucleoside 5'-phosphate + H(+)
EC:3.1.4.17	0.998	3',5'-cyclic-nucleotide phosphodiesterase.
RHEA:16957	0.523	3',5'-cyclic GMP + H2O = GMP + H(+)
EC:3.1.4.35	0.523	3',5'-cyclic-GMP phosphodiesterase.
RHEA:25277	0.326	3',5'-cyclic AMP + H2O = AMP + H(+)
EC:3.1.4.53	0.326	3',5'-cyclic-AMP phosphodiesterase.

[back to server]