StarFunc result for job id Q9HCS2

User Input

>input (524 residues)
MSLLSLPWLGLRPVATSPWLLLLLVVGSWLLARILAWTYAFYNNCRRLQCFPQPPKRNWF
WGHLGLITPTEEGLKNSTQMSATYSQGFTVWLGPIIPFIVLCHPDTIRSITNASAAIAPK
DNLFIRFLKPWLGEGILLSGGDKWSRHRRMLTPAFHFNILKSYITIFNKSANIMLDKWQH
LASEGSSRLDMFEHISLMTLDSLQKCIFSFDSHCQERPSEYIATILELSALVEKRSQHIL
QHMDFLYYLSHDGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFID
VLLLSKDEDGKALSDEDIRAEADTFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQE
LLKDRDPKEIEWDDLAQLPFLTMCVKESLRLHPPAPFISRCCTQDIVLPDGRVIPKGITC
LIDIIGVHHNPTVWPDPEVYDPFRFDPENSKGRSPLAFIPFSAGPRNCIGQAFAMAEMKV
VLALMLLHFRFLPDHTEPRRKLELIMRAEGGLWLRVEPLNVSLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HCS2	1.000	1.000	5.308E-84	524	1.000	1.000	Q9HCS2.pdb.gz	CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens OX=9606 GN=CYP4F12 PE=1 SV=3
2	AFDB:Q9HBI6	0.955	0.955	3.794E-69	524	0.830	0.830	Q9HBI6.pdb.gz	CP4FB_HUMAN Cytochrome P450 4F11 OS=Homo sapiens OX=9606 GN=CYP4F11 PE=1 SV=3
3	AFDB:P78329	0.942	0.949	2.870E-67	520	0.811	0.817	P78329.pdb.gz	CP4F2_HUMAN Cytochrome P450 4F2 OS=Homo sapiens OX=9606 GN=CYP4F2 PE=1 SV=1
4	AFDB:Q08477	0.937	0.944	9.222E-66	520	0.779	0.785	Q08477.pdb.gz	CP4F3_HUMAN Cytochrome P450 4F3 OS=Homo sapiens OX=9606 GN=CYP4F3 PE=1 SV=2
5	AFDB:P98187	0.949	0.956	4.268E-65	520	0.775	0.781	P98187.pdb.gz	CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens OX=9606 GN=CYP4F8 PE=1 SV=1
6	AFDB:P33274	0.947	0.947	2.261E-64	524	0.752	0.752	P33274.pdb.gz	CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus OX=10116 GN=Cyp4f1 PE=1 SV=1
7	AFDB:P51871	0.967	0.943	1.967E-63	537	0.698	0.682	P51871.pdb.gz	CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus OX=10116 GN=Cyp4f6 PE=2 SV=1
8	AFDB:P51870	0.956	0.952	3.229E-63	526	0.702	0.700	P51870.pdb.gz	CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus OX=10116 GN=Cyp4f5 PE=2 SV=1
9	AFDB:P51869	0.930	0.933	4.045E-63	522	0.746	0.749	P51869.pdb.gz	CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus OX=10116 GN=Cyp4f4 PE=1 SV=1
10	AFDB:Q99N16	0.935	0.935	3.664E-61	524	0.727	0.727	Q99N16.pdb.gz	CP4F3_MOUSE Cytochrome P450 4F3 OS=Mus musculus OX=10090 GN=Cyp4f3 PE=1 SV=2
11	PDB:5veuC	0.751	0.833	1.155E-24	469	0.229	0.256	5veuC.pdb.gz	The X-Ray Crystal Structure of the Human Mono-Oxygenase Cytochrome P450 3A5-Ritonavir Complex Reveals Active Site Differences between P450s 3A4 and 3A5.
12	PDB:5te8B	0.752	0.830	2.598E-24	471	0.216	0.240	5te8B.pdb.gz	Structural basis for regiospecific midazolam oxidation by human cytochrome P450 3A4.
13	PDB:7mk8B	0.739	0.827	3.255E-24	465	0.223	0.252	7mk8B.pdb.gz	Structural Basis for the Diminished Ligand Binding and Catalytic Ability of Human Fetal-Specific CYP3A7.
14	PDB:5veuL	0.699	0.809	2.831E-23	448	0.223	0.261	5veuL.pdb.gz	The X-Ray Crystal Structure of the Human Mono-Oxygenase Cytochrome P450 3A5-Ritonavir Complex Reveals Active Site Differences between P450s 3A4 and 3A5.
15	PDB:2j0dB	0.693	0.807	5.320E-23	445	0.231	0.272	2j0dB.pdb.gz	Structural Basis for Ligand Promiscuity in Cytochrome P450 3A4
16	PDB:7kvjA	0.680	0.847	2.694E-22	415	0.208	0.263	7kvjA.pdb.gz	Rational Design of CYP3A4 Inhibitors: A One-Atom Linker Elongation in Ritonavir-Like Compounds Leads to a Marked Improvement in the Binding Strength.
17	PDB:3k9vA	0.751	0.842	1.305E-21	464	0.197	0.222	3k9vA.pdb.gz	Crystal structure of CYP24A1, a mitochondrial cytochrome P450 involved in vitamin D metabolism.
18	PDB:7n3mAAA	0.733	0.872	1.788E-21	437	0.204	0.245	7n3mAAA.pdb.gz	Discovery of Novel 3-Piperidinyl Pyridine Derivatives as Highly Potent and Selective Cholesterol 24-Hydroxylase (CH24H) Inhibitors.
19	PDB:5jlcA	0.717	0.741	5.771E-21	506	0.195	0.202	5jlcA.pdb.gz	Crystal Structures of Full-Length Lanosterol 14 alpha-Demethylases of Prominent Fungal Pathogens Candida albicans and Candida glabrata Provide Tools for Antifungal Discovery.
20	PDB:3mzsA	0.720	0.796	1.781E-20	470	0.181	0.202	3mzsA.pdb.gz	Structural Basis for Three-step Sequential Catalysis by the Cholesterol Side Chain Cleavage Enzyme CYP11A1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P33274	0.0	827	524	0.752	0.752	CP4F1_RAT Cytochrome P450 4F1 OS=Rattus norvegicus OX=10116 GN=Cyp4f1 PE=1 SV=1
2	P51869	0.0	805	522	0.746	0.749	CP4F4_RAT Cytochrome P450 4F4 OS=Rattus norvegicus OX=10116 GN=Cyp4f4 PE=1 SV=1
3	P51870	0.0	770	526	0.706	0.703	CP4F5_RAT Cytochrome P450 4F5 OS=Rattus norvegicus OX=10116 GN=Cyp4f5 PE=2 SV=1
4	P51871	0.0	774	537	0.700	0.683	CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus OX=10116 GN=Cyp4f6 PE=2 SV=1
5	P78329	0.0	891	520	0.811	0.817	CP4F2_HUMAN Cytochrome P450 4F2 OS=Homo sapiens OX=9606 GN=CYP4F2 PE=1 SV=1
6	P98187	0.0	832	520	0.756	0.762	CP4F8_HUMAN Cytochrome P450 4F8 OS=Homo sapiens OX=9606 GN=CYP4F8 PE=1 SV=1
7	Q08477	0.0	846	520	0.779	0.785	CP4F3_HUMAN Cytochrome P450 4F3 OS=Homo sapiens OX=9606 GN=CYP4F3 PE=1 SV=2
8	Q6NT55	0.0	671	531	0.592	0.584	CP4FN_HUMAN Ultra-long-chain fatty acid omega-hydroxylase OS=Homo sapiens OX=9606 GN=CYP4F22 PE=1 SV=1
9	Q99N16	0.0	788	524	0.727	0.727	CP4F3_MOUSE Cytochrome P450 4F3 OS=Mus musculus OX=10090 GN=Cyp4f3 PE=1 SV=2
10	Q9HBI6	0.0	890	524	0.830	0.830	CP4FB_HUMAN Cytochrome P450 4F11 OS=Homo sapiens OX=9606 GN=CYP4F11 PE=1 SV=3
11	Q9HCS2	0.0	1080	524	1.000	1.000	CP4FC_HUMAN Cytochrome P450 4F12 OS=Homo sapiens OX=9606 GN=CYP4F12 PE=1 SV=3
12	P08516	1.72e-140	417	509	0.414	0.426	CP4AA_RAT Cytochrome P450 4A10 OS=Rattus norvegicus OX=10116 GN=Cyp4a10 PE=1 SV=2
13	O88833	2.10e-137	409	509	0.403	0.415	CP4AA_MOUSE Cytochrome P450 4A10 OS=Mus musculus OX=10090 GN=Cyp4a10 PE=1 SV=2
14	P24464	1.60e-136	406	508	0.405	0.417	CP4AC_RAT Cytochrome P450 4A12 OS=Rattus norvegicus OX=10116 GN=Cyp4a12 PE=1 SV=2
15	Q02928	1.09e-135	405	519	0.420	0.424	CP4AB_HUMAN Cytochrome P450 4A11 OS=Homo sapiens OX=9606 GN=CYP4A11 PE=1 SV=1
16	P20817	3.77e-135	403	507	0.412	0.426	CP4AE_RAT Cytochrome P450 4A14 OS=Rattus norvegicus OX=10116 GN=Cyp4a14 PE=1 SV=2
17	P15129	1.08e-134	402	511	0.395	0.405	CP4B1_RAT Cytochrome P450 4B1 OS=Rattus norvegicus OX=10116 GN=Cyp4b1 PE=1 SV=3
18	P13584	7.24e-134	400	511	0.403	0.413	CP4B1_HUMAN Cytochrome P450 4B1 OS=Homo sapiens OX=9606 GN=CYP4B1 PE=1 SV=2
19	Q8N118	1.90e-133	399	509	0.374	0.385	CP4X1_HUMAN Cytochrome P450 4X1 OS=Homo sapiens OX=9606 GN=CYP4X1 PE=1 SV=1
20	Q91WL5	6.28e-132	395	508	0.397	0.409	CP4CA_MOUSE Cytochrome P450 4A12A OS=Mus musculus OX=10090 GN=Cyp4a12a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00067 p450	4.2e-132	452.8	Cytochrome P450

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000448998

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419970	0.741	NADPH--cytochrome P450 reductase
2	9606.ENSP00000360247	0.594	Cytochrome P450 2J2
3	9606.ENSP00000333212	0.577	Cytochrome P450 2U1
4	9606.ENSP00000260970	0.524	Peptidyl-prolyl cis-trans isomerase G
5	9606.ENSP00000285979	0.513	Cytochrome P450 2C18
6	9606.ENSP00000251566	0.512	UDP-glucuronosyltransferase 2A3
7	9606.ENSP00000258415	0.505	Sterol 26-hydroxylase, mitochondrial
8	9606.ENSP00000333534	0.503	Cytochrome P450 2F1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016705	1.000	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0004497	1.000	monooxygenase activity
GO:0005488	0.991	binding
GO:0005515	0.753	protein binding
GO:0008395	0.565	steroid hydroxylase activity
GO:0097159	0.563	organic cyclic compound binding
GO:1901363	0.558	heterocyclic compound binding
GO:0036094	0.447	small molecule binding
GO:0016709	0.436	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0020037	0.429	heme binding
GO:0043167	0.373	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.995	primary metabolic process
GO:0019752	0.995	carboxylic acid metabolic process
GO:0006629	0.960	lipid metabolic process
GO:0032787	0.943	monocarboxylic acid metabolic process
GO:0006631	0.913	fatty acid metabolic process
GO:0050896	0.499	response to stimulus
GO:1901615	0.372	organic hydroxy compound metabolic process
GO:1901360	0.367	organic cyclic compound metabolic process
GO:0065007	0.306	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.-.-	1.000	Acting on paired donors, with incorporation or reduction of molecular oxygen. The oxygen incorporated need not be derived from O2.
RHEA:43836	0.565	cholesterol + H(+) + NADPH + O2 = 26-hydroxycholesterol + H2O + NADP(+)
EC:1.14.13.-	0.436	With NADH or NADPH as one donor, and incorporation of one atom of oxygen.

[back to server]