StarFunc result for job id Q9HCS4

User Input

>input (588 residues)
MPQLGGGGGGGGGGSGGGGGSSAGAAGGGDDLGANDELIPFQDEGGEEQEPSSDSASAQR
DLDEVKSSLVNESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYP
GYPFLMIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKVP
VVQHPHHMHPLTPLITYSNDHFSPGSPPTHLSPEIDPKTGIPRPPHPSELSPYYPLSPGA
VGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGL
PTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKPLNAFMLYMKEM
RAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYG
KKKKRKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPA
TPSAALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAASSSGQMGSQPP
LLSRPLPLGSMPTALLASPPSFPATLHAHQALPVLQAQPLSLVTKSAH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HCS4	0.999	0.999	3.371E-77	588	1.000	1.000	Q9HCS4.pdb.gz	TF7L1_HUMAN Transcription factor 7-like 1 OS=Homo sapiens OX=9606 GN=TCF7L1 PE=1 SV=1
2	AFDB:A0A2R8Q786	0.184	0.173	1.964E-37	630	0.605	0.565	A0A2R8Q786.pdb.gz
3	AFDB:Q8IMA8	0.155	0.084	3.224E-9	1192	0.277	0.137	Q8IMA8.pdb.gz	PANG2_DROME Protein pangolin, isoform J OS=Drosophila melanogaster OX=7227 GN=pan PE=1 SV=2
4	AFDB:O94900	0.128	0.141	1.790E-5	526	0.156	0.175	O94900.pdb.gz	TOX_HUMAN Thymocyte selection-associated high mobility group box protein TOX OS=Homo sapiens OX=9606 GN=TOX PE=1 SV=3
5	AFDB:F1Q6M9	0.133	0.032	8.680E-5	2623	0.172	0.039	F1Q6M9.pdb.gz	F1Q6M9_DANRE Capicua transcriptional repressor b OS=Danio rerio OX=7955 GN=cicb PE=4 SV=2
6	AFDB:G5EG29	0.074	0.050	8.762E-3	968	0.146	0.089	G5EG29.pdb.gz	G5EG29_CAEEL cGMP-dependent protein kinase interacting domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mel-11 PE=1 SV=1
7	AFDB:P18146	0.060	0.062	1.424E-2	543	0.162	0.175	P18146.pdb.gz	EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens OX=9606 GN=EGR1 PE=1 SV=1
8	AFDB:Q18820	0.059	0.041	1.424E-2	1003	0.138	0.081	Q18820.pdb.gz	Q18820_CAEEL IRS-type PTB domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ist-1 PE=1 SV=4
9	AFDB:Q9U1H0	0.140	0.048	1.424E-2	1832	0.182	0.058	Q9U1H0.pdb.gz	CIC_DROME Putative transcription factor capicua OS=Drosophila melanogaster OX=7227 GN=cic PE=1 SV=2
10	AFDB:Q4WXZ7	0.072	0.060	1.929E-2	772	0.156	0.119	Q4WXZ7.pdb.gz	Q4WXZ7_ASPFU C2H2 transcription factor (Swi5), putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G11250 PE=4 SV=1
11	PDB:1j5nA	0.106	0.595	2.968E-2	93	0.036	0.226	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
12	PDB:7ploI	0.079	0.102	7.879E-1	451	0.017	0.022	7ploI.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
13	PDB:5wlcNB	0.060	0.163	3.595	142	0.037	0.155	5wlcNB.pdb.gz	The complete structure of the small-subunit processome.
14	PDB:6ke6A8	0.045	0.047	4.059	548	0.014	0.015	6ke6A8.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
15	PDB:7pubCI	0.046	0.060	4.059	427	0.029	0.040	7pubCI.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
16	PDB:6r7fC	0.075	0.097	4.313	403	0.017	0.025	6r7fC.pdb.gz
17	PDB:6ytvA	0.064	0.127	4.313	252	0.019	0.044	6ytvA.pdb.gz
18	PDB:7mq8LL	0.058	0.064	4.583	510	0.029	0.033	7mq8LL.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7zs9M	0.066	0.112	4.583	310	0.017	0.032	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
20	PDB:3jb9W	0.047	0.060	6.209	426	0.043	0.059	3jb9W.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A9A2	0.0	547	652	0.595	0.537	A0A8I6A9A2_RAT Transcription factor 7 like 2 OS=Rattus norvegicus OX=10116 GN=Tcf7l2 PE=1 SV=1
2	A0A8I6AGH1	0.0	566	604	0.595	0.579	A0A8I6AGH1_RAT Transcription factor 7 like 2 OS=Rattus norvegicus OX=10116 GN=Tcf7l2 PE=1 SV=1
3	A0A8I6ARM6	0.0	579	581	0.595	0.602	A0A8I6ARM6_RAT Transcription factor 7 like 2 OS=Rattus norvegicus OX=10116 GN=Tcf7l2 PE=1 SV=1
4	D3YWT3	0.0	523	442	0.498	0.663	D3YWT3_MOUSE Transcription factor 7 like 2, T cell specific, HMG box OS=Mus musculus OX=10090 GN=Tcf7l2 PE=1 SV=1
5	D3Z9D1	0.0	572	598	0.597	0.587	D3Z9D1_RAT Transcription factor 7 like 2 OS=Rattus norvegicus OX=10116 GN=Tcf7l2 PE=1 SV=4
6	P70062	0.0	771	554	0.741	0.787	T7L1A_XENLA Transcription factor 7-like 1-A OS=Xenopus laevis OX=8355 GN=tcf7l1-a PE=1 SV=1
7	Q71G54	0.0	535	477	0.478	0.589	Q71G54_DANRE Transcription factor 7-like 2 OS=Danio rerio OX=7955 GN=tcf4 PE=2 SV=1
8	Q800Q5	0.0	667	551	0.690	0.737	T7L1B_DANRE Transcription factor 7-like 1-B OS=Danio rerio OX=7955 GN=tcf7l1b PE=2 SV=1
9	Q90ZB6	0.0	752	551	0.743	0.793	T7L1B_XENLA Transcription factor 7-like 1-B OS=Xenopus laevis OX=8355 GN=tcf7l1-b PE=1 SV=1
10	Q9HCS4	0.0	1176	588	1.000	1.000	TF7L1_HUMAN Transcription factor 7-like 1 OS=Homo sapiens OX=9606 GN=TCF7L1 PE=1 SV=1
11	Q9NQB0	0.0	544	619	0.554	0.527	TF7L2_HUMAN Transcription factor 7-like 2 OS=Homo sapiens OX=9606 GN=TCF7L2 PE=1 SV=2
12	Q9YHE8	0.0	674	560	0.684	0.718	T7L1A_DANRE Transcription factor 7-like 1-A OS=Danio rerio OX=7955 GN=tcf7l1a PE=1 SV=1
13	Q9Z1J1	0.0	928	584	0.917	0.923	TF7L1_MOUSE Transcription factor 7-like 1 OS=Mus musculus OX=10090 GN=Tcf7l1 PE=1 SV=2
14	Q924A0	1.66e-180	519	459	0.498	0.638	TF7L2_MOUSE Transcription factor 7-like 2 OS=Mus musculus OX=10090 GN=Tcf7l2 PE=1 SV=2
15	A0A8I6A761	3.20e-176	508	465	0.497	0.628	A0A8I6A761_RAT Transcription factor 7 like 2 OS=Rattus norvegicus OX=10116 GN=Tcf7l2 PE=1 SV=1
16	D4A8X6	4.14e-118	354	299	0.337	0.662	D4A8X6_RAT Transcription factor 7 like 2 OS=Rattus norvegicus OX=10116 GN=Tcf7l2 PE=3 SV=4
17	Q9UJU2	2.40e-114	348	399	0.355	0.524	LEF1_HUMAN Lymphoid enhancer-binding factor 1 OS=Homo sapiens OX=9606 GN=LEF1 PE=1 SV=1
18	Q9QXN1	8.04e-114	347	397	0.359	0.531	LEF1_RAT Lymphoid enhancer-binding factor 1 OS=Rattus norvegicus OX=10116 GN=Lef1 PE=2 SV=1
19	P27782	1.93e-113	345	397	0.359	0.531	LEF1_MOUSE Lymphoid enhancer-binding factor 1 OS=Mus musculus OX=10090 GN=Lef1 PE=1 SV=1
20	O93345	7.21e-101	312	369	0.330	0.526	O93345_CHICK Lymphiod enhancer binding factor 1 OS=Gallus gallus OX=9031 GN=Lef-1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08347 CTNNB1_binding	3.5e-85	296.9	N-terminal CTNNB1 binding
2	PF19420 DDAH_eukar	6e+02	11.0	N,N dimethylarginine dimethylhydrolase, eukaryotic
3	PF00505 HMG_box	4.7e-18	76.7	HMG (high mobility group) box
4	PF09011 HMG_box_2	2.5e-05	36.1	HMG-box domain
5	PF16136 NINJA_B	2.1e+02	13.7	Putative nuclear localisation signal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282111

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344456	0.999	Catenin beta-1
2	9606.ENSP00000384625	0.963	Serine/threonine-protein kinase NLK
3	9606.ENSP00000302625	0.955	Axin-2
4	9606.ENSP00000466542	0.945	Transducin-like enhancer protein 2
5	9606.ENSP00000479618	0.932	Myc proto-oncogene protein
6	9606.ENSP00000395654	0.916	Transcription activator BRG1
7	9606.ENSP00000309572	0.909	Telomerase reverse transcriptase
8	9606.ENSP00000262367	0.903	CREB-binding protein
9	9606.ENSP00000355657	0.903	Histone H3.1t
10	9606.ENSP00000296417	0.901	Histone H2A.Z
11	9606.ENSP00000308405	0.901	Histone H2A.V
12	9606.ENSP00000274764	0.900	Histone H2B type 1-A
13	9606.ENSP00000289316	0.900	Histone H2B type 1-D
14	9606.ENSP00000328484	0.900	Histone H2A type 1-J
15	9606.ENSP00000332194	0.900	Histone H2A type 2-C
16	9606.ENSP00000341094	0.900	Histone H2A type 1-D
17	9606.ENSP00000349430	0.900	Histone H2B type 1-K
18	9606.ENSP00000358151	0.900	Histone H2B type 2-E
19	9606.ENSP00000366618	0.900	Histone H2B type 1-L
20	9606.ENSP00000367022	0.900	Histone H2A type 1-C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	0.995	sequence-specific double-stranded DNA binding
GO:0003700	0.965	DNA-binding transcription factor activity
GO:0000981	0.760	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.435	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0006357	0.992	regulation of transcription by RNA polymerase II
GO:0048523	0.975	negative regulation of cellular process
GO:0009987	0.966	cellular process
GO:0032502	0.911	developmental process
GO:0048856	0.904	anatomical structure development
GO:0032501	0.903	multicellular organismal process
GO:0051172	0.827	negative regulation of nitrogen compound metabolic process
GO:0031324	0.813	negative regulation of cellular metabolic process
GO:0048518	0.796	positive regulation of biological process
GO:0010605	0.777	negative regulation of macromolecule metabolic process
GO:0045934	0.777	negative regulation of nucleobase-containing compound metabolic process
GO:0007275	0.769	multicellular organism development
GO:0009890	0.762	negative regulation of biosynthetic process
GO:0010558	0.747	negative regulation of macromolecule biosynthetic process
GO:0031327	0.743	negative regulation of cellular biosynthetic process
GO:0048522	0.740	positive regulation of cellular process
GO:0050896	0.725	response to stimulus
GO:1902679	0.720	negative regulation of RNA biosynthetic process
GO:0045892	0.713	negative regulation of DNA-templated transcription
GO:0010604	0.682	positive regulation of macromolecule metabolic process
GO:0048513	0.648	animal organ development
GO:0051173	0.612	positive regulation of nitrogen compound metabolic process
GO:0031325	0.558	positive regulation of cellular metabolic process
GO:0045935	0.497	positive regulation of nucleobase-containing compound metabolic process
GO:0051716	0.488	cellular response to stimulus
GO:0007154	0.460	cell communication
GO:0023052	0.459	signaling
GO:0007165	0.446	signal transduction
GO:0048731	0.433	system development
GO:0051254	0.417	positive regulation of RNA metabolic process
GO:0031328	0.415	positive regulation of cellular biosynthetic process
GO:0045893	0.412	positive regulation of DNA-templated transcription
GO:0045944	0.379	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.986	intracellular organelle lumen
GO:0005654	0.981	nucleoplasm
GO:0005737	0.878	cytoplasm
GO:0005829	0.589	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]