StarFunc result for job id Q9HCT0

User Input

>input (170 residues)
MRRRLWLGLAWLLLARAPDAAGTPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGR
VQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIE
ENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HCT0	1.000	1.000	1.778E-32	170	1.000	1.000	Q9HCT0.pdb.gz	FGF22_HUMAN Fibroblast growth factor 22 OS=Homo sapiens OX=9606 GN=FGF22 PE=1 SV=1
2	AFDB:Q9ESS2	0.814	0.854	1.064E-26	162	0.812	0.852	Q9ESS2.pdb.gz	FGF22_MOUSE Fibroblast growth factor 22 OS=Mus musculus OX=10090 GN=Fgf22 PE=2 SV=1
3	AFDB:P70492	0.835	0.662	1.134E-21	215	0.471	0.372	P70492.pdb.gz	FGF10_RAT Fibroblast growth factor 10 OS=Rattus norvegicus OX=10116 GN=Fgf10 PE=2 SV=1
4	AFDB:O42407	0.820	0.660	2.920E-21	212	0.453	0.363	O42407.pdb.gz	O42407_CHICK Fibroblast growth factor OS=Gallus gallus OX=9031 PE=2 SV=2
5	AFDB:Q1XG76	0.816	0.673	4.558E-21	207	0.529	0.435	Q1XG76.pdb.gz	Q1XG76_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=si:dkeyp-74c5.3 PE=2 SV=1
6	AFDB:P21781	0.774	0.679	6.969E-20	194	0.406	0.356	P21781.pdb.gz	FGF7_HUMAN Fibroblast growth factor 7 OS=Homo sapiens OX=9606 GN=FGF7 PE=1 SV=1
7	AFDB:Q4VBV7	0.827	0.701	2.121E-19	201	0.465	0.393	Q4VBV7.pdb.gz
8	AFDB:A0A0R4ITI2	0.763	0.680	3.625E-18	191	0.447	0.398	A0A0R4ITI2.pdb.gz
9	AFDB:Q2HXK8	0.765	0.643	3.177E-17	203	0.406	0.340	Q2HXK8.pdb.gz	FGF16_DANRE Fibroblast growth factor 16 OS=Danio rerio OX=7955 GN=fgf16 PE=2 SV=1
10	AFDB:P11487	0.757	0.541	7.739E-17	239	0.424	0.301	P11487.pdb.gz	FGF3_HUMAN Fibroblast growth factor 3 OS=Homo sapiens OX=9606 GN=FGF3 PE=1 SV=1
11	PDB:3f1rA	0.742	0.802	1.226E-14	157	0.353	0.382	3f1rA.pdb.gz	Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
12	PDB:4jq0A	0.729	0.874	8.906E-13	141	0.271	0.326	4jq0A.pdb.gz	Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
13	PDB:1ry7A	0.732	0.819	7.805E-12	151	0.312	0.351	1ry7A.pdb.gz
14	PDB:6b0tA	0.608	0.226	4.092E-5	487	0.094	0.033	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
15	PDB:4qd2B	0.634	0.740	9.969E-5	143	0.088	0.105	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
16	PDB:4a7zA	0.578	0.134	1.054E-4	881	0.141	0.027	4a7zA.pdb.gz	Crystal Structure of Bifunctional Aldos-2-Ulose Dehydratase/Isomerase from Phanerochaete Chrysosporium with the Reaction Intermediate Ascopyrone M.
17	PDB:1hcdA	0.533	0.727	6.256E-4	118	0.124	0.178	1hcdA.pdb.gz
18	PDB:7t3qA	0.546	0.053	9.236E-4	2103	0.176	0.014	7t3qA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
19	PDB:7t3pA	0.528	0.051	2.013E-3	2066	0.188	0.015	7t3pA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
20	PDB:1t9fA	0.524	0.503	2.972E-3	178	0.082	0.079	1t9fA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HCT0	1.11e-120	339	170	1.000	1.000	FGF22_HUMAN Fibroblast growth factor 22 OS=Homo sapiens OX=9606 GN=FGF22 PE=1 SV=1
2	Q9ESS2	1.86e-81	239	162	0.706	0.741	FGF22_MOUSE Fibroblast growth factor 22 OS=Mus musculus OX=10090 GN=Fgf22 PE=2 SV=1
3	O15520	3.17e-56	177	208	0.459	0.375	FGF10_HUMAN Fibroblast growth factor 10 OS=Homo sapiens OX=9606 GN=FGF10 PE=1 SV=1
4	P70492	3.93e-56	177	215	0.459	0.363	FGF10_RAT Fibroblast growth factor 10 OS=Rattus norvegicus OX=10116 GN=Fgf10 PE=2 SV=1
5	O35565	5.05e-55	174	209	0.453	0.368	FGF10_MOUSE Fibroblast growth factor 10 OS=Mus musculus OX=10090 GN=Fgf10 PE=2 SV=1
6	Q1XG76	2.26e-54	172	207	0.488	0.401	Q1XG76_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=si:dkeyp-74c5.3 PE=2 SV=1
7	O42407	7.69e-53	169	212	0.429	0.344	O42407_CHICK Fibroblast growth factor OS=Gallus gallus OX=9031 PE=2 SV=2
8	Q8AY90	2.30e-45	149	201	0.424	0.358	Q8AY90_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf10 PE=2 SV=1
9	P21781	1.28e-44	147	194	0.400	0.351	FGF7_HUMAN Fibroblast growth factor 7 OS=Homo sapiens OX=9606 GN=FGF7 PE=1 SV=1
10	Q1XG75	1.12e-43	145	187	0.412	0.374	Q1XG75_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf10b PE=2 SV=1
11	P36363	4.69e-41	138	194	0.394	0.345	FGF7_MOUSE Fibroblast growth factor 7 OS=Mus musculus OX=10090 GN=Fgf7 PE=2 SV=1
12	Q02195	4.55e-38	130	194	0.382	0.335	FGF7_RAT Fibroblast growth factor 7 OS=Rattus norvegicus OX=10116 GN=Fgf7 PE=1 SV=1
13	Q2LJ24	2.00e-34	122	208	0.365	0.298	Q2LJ24_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf20b PE=2 SV=1
14	P36364	2.45e-34	121	208	0.394	0.322	FGF9_RAT Fibroblast growth factor 9 OS=Rattus norvegicus OX=10116 GN=Fgf9 PE=2 SV=2
15	P54130	2.45e-34	121	208	0.394	0.322	FGF9_MOUSE Fibroblast growth factor 9 OS=Mus musculus OX=10090 GN=Fgf9 PE=2 SV=2
16	P31371	2.62e-34	121	208	0.394	0.322	FGF9_HUMAN Fibroblast growth factor 9 OS=Homo sapiens OX=9606 GN=FGF9 PE=1 SV=3
17	O43320	6.59e-34	120	207	0.365	0.300	FGF16_HUMAN Fibroblast growth factor 16 OS=Homo sapiens OX=9606 GN=FGF16 PE=1 SV=1
18	Q9NP95	9.08e-34	120	211	0.394	0.318	FGF20_HUMAN Fibroblast growth factor 20 OS=Homo sapiens OX=9606 GN=FGF20 PE=1 SV=1
19	Q2HXK8	1.29e-33	119	203	0.353	0.296	FGF16_DANRE Fibroblast growth factor 16 OS=Danio rerio OX=7955 GN=fgf16 PE=2 SV=1
20	Q9ESL9	1.64e-33	119	211	0.371	0.299	FGF20_MOUSE Fibroblast growth factor 20 OS=Mus musculus OX=10090 GN=Fgf20 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06268 Fascin	1.5e+02	14.0	Fascin domain
2	PF00167 FGF	1.4e-37	139.9	Fibroblast growth factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000215530

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000410294	0.945	Fibroblast growth factor receptor 2
2	9606.ENSP00000263025	0.931	Mitogen-activated protein kinase 3
3	9606.ENSP00000215832	0.920	Mitogen-activated protein kinase 1
4	9606.ENSP00000256078	0.912	GTPase KRas
5	9606.ENSP00000358548	0.911	GTPase NRas
6	9606.ENSP00000407586	0.911	GTPase HRas
7	9606.ENSP00000393312	0.892	Fibroblast growth factor receptor 1
8	9606.ENSP00000369442	0.867	Klotho
9	9606.ENSP00000292408	0.836	Fibroblast growth factor receptor 4
10	9606.ENSP00000339824	0.836	Fibroblast growth factor receptor 3
11	9606.ENSP00000237837	0.824	Fibroblast growth factor 23
12	9606.ENSP00000321797	0.823	Fibroblast growth factor 8
13	9606.ENSP00000274625	0.801	Fibroblast growth factor 18
14	9606.ENSP00000263923	0.799	Vascular endothelial growth factor receptor 2
15	9606.ENSP00000257290	0.789	Platelet-derived growth factor receptor alpha
16	9606.ENSP00000371770	0.789	Fibroblast growth factor-binding protein 1
17	9606.ENSP00000282397	0.776	Vascular endothelial growth factor receptor 1
18	9606.ENSP00000381498	0.772	Fibroblast growth factor receptor-like 1
19	9606.ENSP00000251287	0.767	Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2
20	9606.ENSP00000288135	0.751	Mast/stem cell growth factor receptor Kit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding
GO:0048018	0.983	receptor ligand activity
GO:0008083	0.935	growth factor activity
GO:0005104	0.351	fibroblast growth factor receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048856	0.990	anatomical structure development
GO:0009987	0.989	cellular process
GO:0032501	0.986	multicellular organismal process
GO:0050794	0.985	regulation of cellular process
GO:0050896	0.973	response to stimulus
GO:0048518	0.964	positive regulation of biological process
GO:0048522	0.899	positive regulation of cellular process
GO:0007154	0.857	cell communication
GO:0023052	0.850	signaling
GO:0051716	0.847	cellular response to stimulus
GO:0007165	0.828	signal transduction
GO:0007275	0.800	multicellular organism development
GO:0048731	0.690	system development
GO:0007166	0.644	cell surface receptor signaling pathway
GO:0042127	0.580	regulation of cell population proliferation
GO:0048513	0.577	animal organ development
GO:0019222	0.516	regulation of metabolic process
GO:0007169	0.504	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0070848	0.491	response to growth factor
GO:0009653	0.481	anatomical structure morphogenesis
GO:0071363	0.467	cellular response to growth factor stimulus
GO:0009888	0.450	tissue development
GO:0060255	0.432	regulation of macromolecule metabolic process
GO:0031323	0.432	regulation of cellular metabolic process
GO:0009893	0.432	positive regulation of metabolic process
GO:0080090	0.431	regulation of primary metabolic process
GO:0008284	0.425	positive regulation of cell population proliferation
GO:0048583	0.422	regulation of response to stimulus
GO:0010604	0.416	positive regulation of macromolecule metabolic process
GO:0051239	0.373	regulation of multicellular organismal process
GO:0051171	0.369	regulation of nitrogen compound metabolic process
GO:0010646	0.368	regulation of cell communication
GO:0031325	0.363	positive regulation of cellular metabolic process
GO:0009966	0.359	regulation of signal transduction
GO:0048584	0.350	positive regulation of response to stimulus
GO:0048519	0.337	negative regulation of biological process
GO:0051173	0.337	positive regulation of nitrogen compound metabolic process
GO:0050793	0.323	regulation of developmental process
GO:0030154	0.315	cell differentiation
GO:1902533	0.313	positive regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.996	extracellular region
GO:0005622	0.978	intracellular anatomical structure
GO:0043226	0.928	organelle
GO:0043227	0.914	membrane-bounded organelle
GO:0043229	0.913	intracellular organelle
GO:0005737	0.912	cytoplasm
GO:0043231	0.903	intracellular membrane-bounded organelle
GO:0005634	0.786	nucleus
GO:0043233	0.775	organelle lumen
GO:0070013	0.773	intracellular organelle lumen
GO:0012505	0.753	endomembrane system
GO:0071944	0.720	cell periphery
GO:0031981	0.487	nuclear lumen
GO:0005886	0.479	plasma membrane
GO:0043228	0.329	non-membrane-bounded organelle
GO:0043232	0.324	intracellular non-membrane-bounded organelle
GO:0009986	0.308	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]