StarFunc result for job id Q9HCU4

User Input

>input (1400 residues)
MRSPATGVPLPTPPPPLLLLLLLLLPPPLLGDQVGPCRSLGSRGRGSSGACAPMGWLCPS
SASNLWLYTSRCRDAGTELTGHLVPHHDGLRVWCPESEAHIPLPPAPEGCPWSCRLLGIG
GHLSPQGKLTLPEEHPCLKAPRLRCQSCKLAQAPGLRAGERSPEESLGGRRKRNVNTAPQ
FQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFSLDPVTGA
VTTAEELDRETKSTHVFRVTAQDHGMPRRSALATLTILVTDTNDHDPVFEQQEYKESLRE
NLEVGYEVLTVRATDGDAPPNANILYRLLEGSGGSPSEVFEIDPRSGVIRTRGPVDREEV
ESYQLTVEASDQGRDPGPRSTTAAVFLSVEDDNDNAPQFSEKRYVVQVREDVTPGAPVLR
VTASDRDKGSNAVVHYSIMSGNARGQFYLDAQTGALDVVSPLDYETTKEYTLRVRAQDGG
RPPLSNVSGLVTVQVLDINDNAPIFVSTPFQATVLESVPLGYLVLHVQAIDADAGDNARL
EYRLAGVGHDFPFTINNGTGWISVAAELDREEVDFYSFGVEARDHGTPALTASASVSVTV
LDVNDNNPTFTQPEYTVRLNEDAAVGTSVVTVSAVDRDAHSVITYQITSGNTRNRFSITS
QSGGGLVSLALPLDYKLERQYVLAVTASDGTRQDTAQIVVNVTDANTHRPVFQSSHYTVN
VNEDRPAGTTVVLISATDEDTGENARITYFMEDSIPQFRIDADTGAVTTQAELDYEDQVS
YTLAITARDNGIPQKSDTTYLEILVNDVNDNAPQFLRDSYQGSVYEDVPPFTSVLQISAT
DRDSGLNGRVFYTFQGGDDGDGDFIVESTSGIVRTLRRLDRENVAQYVLRAYAVDKGMPP
ARTPMEVTVTVLDVNDNPPVFEQDEFDVFVEENSPIGLAVARVTATDPDEGTNAQIMYQI
VEGNIPEVFQLDIFSGELTALVDLDYEDRPEYVLVIQATSAPLVSRATVHVRLLDRNDNP
PVLGNFEILFNNYVTNRSSSFPGGAIGRVPAHDPDISDSLTYSFERGNELSLVLLNASTG
ELKLSRALDNNRPLEAIMSVLVSDGVHSVTAQCALRVTIITDEMLTHSITLRLEDMSPER
FLSPLLGLFIQAVAATLATPPDHVVVFNVQRDTDAPGGHILNVSLSVGQPPGPGGGPPFL
PSEDLQERLYLNRSLLTAISAQRVLPFDDNICLREPCENYMRCVSVLRFDSSAPFIASSS
VLFRPIHPVGGLRCRCPPGFTGDYCETEVDLCYSRPCGPHGRCRSREGGYTCLCRDGYTG
EHCEVSARSGRCTPGVCKNGGTCVNLLVGGFKCDCPSGDFEKPYCQVTTRSFPAHSFITF
RGLRQRFHFTLALSFATKER

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G5EDK5	0.303	0.185	0.000	2596	0.284	0.153	G5EDK5.pdb.gz	CELR_CAEEL Cadherin EGF LAG seven-pass G-type receptor fmi-1 OS=Caenorhabditis elegans OX=6239 GN=fmi-1 PE=1 SV=1
2	AFDB:Q9QYP2	0.277	0.191	7.918E-101	2144	0.431	0.282	Q9QYP2.pdb.gz	CELR2_RAT Cadherin EGF LAG seven-pass G-type receptor 2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Celsr2 PE=1 SV=1
3	AFDB:Q9VFH5	0.176	0.129	3.535E-70	1981	0.230	0.163	Q9VFH5.pdb.gz	Q9VFH5_DROME Cadherin 88C OS=Drosophila melanogaster OX=7227 GN=Cad88C PE=4 SV=3
4	AFDB:A0A0A6YWY8	0.246	0.281	2.245E-60	1203	0.155	0.180	A0A0A6YWY8.pdb.gz	A0A0A6YWY8_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
5	AFDB:B5TR11	0.184	0.255	4.577E-52	979	0.133	0.190	B5TR11.pdb.gz	B5TR11_XENLA Paraxial protocadherin OS=Xenopus laevis OX=8355 GN=PAPC PE=1 SV=1
6	AFDB:Q14BM8	0.251	0.420	9.679E-51	802	0.132	0.231	Q14BM8.pdb.gz	Q14BM8_MOUSE Protocadherin beta 16 OS=Mus musculus OX=10090 GN=Pcdhb16 PE=2 SV=1
7	AFDB:Q6NYV7	0.183	0.250	4.560E-50	1001	0.143	0.200	Q6NYV7.pdb.gz	Q6NYV7_DANRE Protocadherin 10a OS=Danio rerio OX=7955 GN=ZPCR1 PE=2 SV=1
8	AFDB:Q9Y5E7	0.191	0.325	5.274E-50	798	0.131	0.231	Q9Y5E7.pdb.gz	PCDB2_HUMAN Protocadherin beta-2 OS=Homo sapiens OX=9606 GN=PCDHB2 PE=1 SV=1
9	AFDB:Q9Y5H7	0.195	0.287	7.402E-50	936	0.149	0.222	Q9Y5H7.pdb.gz	PCDA5_HUMAN Protocadherin alpha-5 OS=Homo sapiens OX=9606 GN=PCDHA5 PE=2 SV=1
10	AFDB:Q9Y5I4	0.258	0.351	8.155E-50	1007	0.144	0.201	Q9Y5I4.pdb.gz	PCDC2_HUMAN Protocadherin alpha-C2 OS=Homo sapiens OX=9606 GN=PCDHAC2 PE=2 SV=1
11	PDB:7sqcO0	0.088	0.103	1.855E-19	1140	0.081	0.099	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:6velC	0.121	0.656	3.808E-15	209	0.050	0.335	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
13	PDB:4aq1A	0.105	0.154	1.131E-13	721	0.071	0.137	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
14	PDB:5oj2B	0.088	0.154	1.131E-13	692	0.068	0.137	5oj2B.pdb.gz
15	PDB:1e07A	0.088	0.148	3.697E-12	642	0.049	0.106	1e07A.pdb.gz
16	PDB:5a42A	0.074	0.069	1.073E-11	1597	0.095	0.083	5a42A.pdb.gz
17	PDB:6h03A	0.068	0.075	2.382E-10	1223	0.079	0.090	6h03A.pdb.gz
18	PDB:7nycA	0.067	0.063	2.755E-10	1542	0.061	0.055	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
19	PDB:7vonA	0.071	0.071	1.178E-9	1399	0.081	0.081	7vonA.pdb.gz
20	PDB:7q5zA	0.079	0.082	3.104E-9	1344	0.071	0.074	7q5zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A6I8PRU0	0.0	1689	3019	0.594	0.276	A0A6I8PRU0_HUMAN Cadherin EGF LAG seven-pass G-type receptor 1 OS=Homo sapiens OX=9606 GN=CELSR1 PE=1 SV=2
2	A0JBX1	0.0	1952	2941	0.671	0.320	A0JBX1_DANRE Cadherin EGF LAG seven-pass G-type receptor 2 OS=Danio rerio OX=7955 GN=off-road PE=1 SV=1
3	F1QBS8	0.0	1814	3006	0.610	0.284	F1QBS8_DANRE Cadherin EGF LAG seven-pass G-type receptor 1 OS=Danio rerio OX=7955 GN=celsr1b PE=3 SV=1
4	F1R9W4	0.0	1768	3044	0.605	0.278	F1R9W4_DANRE Cadherin EGF LAG seven-pass G-type receptor 1 isoform X2 OS=Danio rerio OX=7955 GN=celsr1a PE=1 SV=3
5	G5EDK5	0.0	618	2596	0.293	0.158	CELR_CAEEL Cadherin EGF LAG seven-pass G-type receptor fmi-1 OS=Caenorhabditis elegans OX=6239 GN=fmi-1 PE=1 SV=1
6	O35161	0.0	1824	3034	0.636	0.293	CELR1_MOUSE Cadherin EGF LAG seven-pass G-type receptor 1 OS=Mus musculus OX=10090 GN=Celsr1 PE=1 SV=3
7	Q80Z62	0.0	667	335	0.236	0.988	Q80Z62_RAT Flamingo-like protein celsr2 (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
8	Q91ZI0	0.0	1680	3301	0.586	0.248	CELR3_MOUSE Cadherin EGF LAG seven-pass G-type receptor 3 OS=Mus musculus OX=10090 GN=Celsr3 PE=2 SV=2
9	Q9NYQ6	0.0	1688	3014	0.594	0.276	CELR1_HUMAN Cadherin EGF LAG seven-pass G-type receptor 1 OS=Homo sapiens OX=9606 GN=CELSR1 PE=1 SV=1
10	Q9NYQ7	0.0	1682	3312	0.585	0.247	CELR3_HUMAN Cadherin EGF LAG seven-pass G-type receptor 3 OS=Homo sapiens OX=9606 GN=CELSR3 PE=1 SV=2
11	Q9QYP2	0.0	1273	2144	0.441	0.288	CELR2_RAT Cadherin EGF LAG seven-pass G-type receptor 2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Celsr2 PE=1 SV=1
12	Q9R0M0	0.0	2768	2919	0.970	0.465	CELR2_MOUSE Cadherin EGF LAG seven-pass G-type receptor 2 OS=Mus musculus OX=10090 GN=Celsr2 PE=1 SV=3
13	Q9V5N8	0.0	1027	3579	0.408	0.160	STAN_DROME Protocadherin-like wing polarity protein stan OS=Drosophila melanogaster OX=7227 GN=stan PE=1 SV=4
14	Q9WU10	7.77e-136	466	4589	0.264	0.080	Q9WU10_RAT Protocadherin OS=Rattus norvegicus OX=10116 GN=Fat1 PE=2 SV=1
15	Q14517	1.61e-135	465	4588	0.261	0.080	FAT1_HUMAN Protocadherin Fat 1 OS=Homo sapiens OX=9606 GN=FAT1 PE=1 SV=2
16	A0A1L1SQU7	1.04e-134	462	4645	0.261	0.079	A0A1L1SQU7_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
17	A0A087WRT4	1.07e-134	462	4602	0.261	0.080	A0A087WRT4_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=2
18	F2Z4A3	1.24e-134	462	4590	0.261	0.080	F2Z4A3_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
19	Q9QXA3	1.39e-134	462	4587	0.263	0.080	Q9QXA3_MOUSE Fat 1 cadherin (Fragment) OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
20	Q6V0I7	2.49e-134	462	4981	0.281	0.079	FAT4_HUMAN Protocadherin Fat 4 OS=Homo sapiens OX=9606 GN=FAT4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	2.4e-174	577.7	Cadherin domain
2	PF08266 Cadherin_2	4.1e-07	41.1	Cadherin-like
3	PF16184 Cadherin_3	3.7e-13	60.7	Cadherin-like
4	PF08758 Cadherin_pro	0.00012	33.5	Cadherin prodomain like
5	PF11844 DUF3364	5.6e+02	12.2	Domain of unknown function (DUF3364)
6	PF00008 EGF	6.9e-06	37.6	EGF-like domain
7	PF07974 EGF_2	0.21	23.3	EGF-like domain
8	PF12947 EGF_3	7.9	18.1	EGF domain
9	PF07645 EGF_CA	0.41	22.2	Calcium-binding EGF domain
10	PF14670 FXa_inhibition	4.4e+02	12.6	Coagulation Factor Xa inhibitory site
11	PF12661 hEGF	3.6e-05	35.4	Human growth factor-like EGF
12	PF17756 RET_CLD1	2.7e-05	35.9	RET Cadherin like domain 1
13	PF14292 SusE	2.9e+02	13.2	SusE outer membrane protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000271332

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358925	0.877	Proline/serine-rich coiled-coil protein 1
2	9606.ENSP00000357040	0.864	Vang-like protein 2
3	9606.ENSP00000256637	0.813	Sortilin
4	9606.ENSP00000347672	0.813	VANGL planar cell polarity protein 1
5	9606.ENSP00000295902	0.746	Prickle planar cell polarity protein 2
6	9606.ENSP00000349678	0.707	Myosin-binding protein H-like
7	9606.ENSP00000345064	0.696	Prickle-like protein 1
8	9606.ENSP00000437489	0.683	Frizzled-3
9	9606.ENSP00000345785	0.670	Frizzled-9
10	9606.ENSP00000430985	0.670	Ankyrin repeat domain-containing protein 6
11	9606.ENSP00000357909	0.666	Semaphorin-6C
12	9606.ENSP00000422185	0.661	Sortilin related VPS10 domain containing receptor 2
13	9606.ENSP00000263054	0.660	Sortilin related VPS10 domain containing receptor 1
14	9606.ENSP00000467290	0.659	Semaphorin-6B
15	9606.ENSP00000470248	0.656	Prickle planar cell polarity protein 3
16	9606.ENSP00000358715	0.655	Sortilin related VPS10 domain containing receptor 3
17	9606.ENSP00000478721	0.628	Tyrosine-protein kinase RYK
18	9606.ENSP00000260197	0.611	Sortilin-related receptor
19	9606.ENSP00000303208	0.607	Proprotein convertase subtilisin/kexin type 9
20	9606.ENSP00000368169	0.606	Segment polarity protein dishevelled homolog DVL-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.936	cellular process
GO:0032501	0.853	multicellular organismal process
GO:0048856	0.852	anatomical structure development
GO:0007275	0.815	multicellular organism development
GO:0065007	0.775	biological regulation
GO:0048731	0.717	system development
GO:0023052	0.673	signaling
GO:0007154	0.629	cell communication
GO:0050794	0.612	regulation of cellular process
GO:0007399	0.519	nervous system development
GO:0050896	0.471	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	0.990	cytoplasm
GO:0005886	0.981	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]