StarFunc result for job id Q9HCU8

User Input

>input (107 residues)
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGP
CTGITRLQRWCRAKQMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9HCU8	1.000	1.000	1.086E-18	107	1.000	1.000	Q9HCU8.pdb.gz	DPOD4_HUMAN DNA polymerase delta subunit 4 OS=Homo sapiens OX=9606 GN=POLD4 PE=1 SV=1
2	AFDB:Q3T0X9	0.649	0.649	9.753E-16	107	0.860	0.860	Q3T0X9.pdb.gz	DPOD4_BOVIN DNA polymerase delta subunit 4 OS=Bos taurus OX=9913 GN=POLD4 PE=1 SV=1
3	AFDB:Q6P6U6	0.653	0.653	7.125E-15	107	0.832	0.832	Q6P6U6.pdb.gz	Q6P6U6_RAT DNA polymerase delta 4, accessory subunit OS=Rattus norvegicus OX=10116 GN=Pold4 PE=4 SV=1
4	PDB:6s1mD	0.591	0.943	4.656E-9	66	0.607	0.985	6s1mD.pdb.gz	Structure of the processive human Pol delta holoenzyme.
5	AFDB:O59835	0.497	0.342	1.274E-4	160	0.327	0.219	O59835.pdb.gz	DPOD4_SCHPO DNA polymerase delta subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdm1 PE=2 SV=1
6	AFDB:F4IBH5	0.192	0.052	1.080	736	0.187	0.027	F4IBH5.pdb.gz	F4IBH5_ARATH Mitochondrial proton/calcium exchanger protein OS=Arabidopsis thaliana OX=3702 GN=LETM2 PE=1 SV=1
7	AFDB:Q66GI4	0.211	0.054	2.052	572	0.159	0.030	Q66GI4.pdb.gz	PRRP1_ARATH Proteinaceous RNase P 1, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PRORP1 PE=1 SV=1
8	AFDB:Q9LIH6	0.189	0.071	2.187	330	0.206	0.067	Q9LIH6.pdb.gz	UNG_ARATH Uracil-DNA glycosylase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=UNG PE=1 SV=1
9	AFDB:Q9VE52	0.181	0.063	2.187	419	0.178	0.045	Q9VE52.pdb.gz	Q9VE52_DROME Cleavage stimulation factor 64 kD subunit OS=Drosophila melanogaster OX=7227 GN=CstF64 PE=1 SV=2
10	AFDB:Q38AM6	0.211	0.047	2.332	718	0.224	0.033	Q38AM6.pdb.gz	Q38AM6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3300 PE=4 SV=1
11	AFDB:F1QI90	0.200	0.039	2.487	913	0.168	0.020	F1QI90.pdb.gz
12	PDB:5f8cB	0.236	0.092	5.628	363	0.121	0.036	5f8cB.pdb.gz
13	PDB:7cpuSN	0.193	0.148	6.001	150	0.131	0.093	7cpuSN.pdb.gz	A male germ-cell-specific ribosome controls male fertility.
14	PDB:7kgbN	0.171	0.161	6.398	116	0.093	0.086	7kgbN.pdb.gz	Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.
15	PDB:7pikC	0.165	0.052	6.398	557	0.112	0.022	7pikC.pdb.gz	Structural basis of transposon end recognition explains central features of Tn7 transposition systems.
16	PDB:3cdiA	0.195	0.065	6.822	516	0.093	0.019	3cdiA.pdb.gz
17	PDB:4v98AN	0.158	0.080	6.822	216	0.168	0.083	4v98AN.pdb.gz	Structural Basis of Assembly Chaperone- Mediated snRNP Formation.
18	PDB:5csnA	0.231	0.252	6.822	94	0.084	0.096	5csnA.pdb.gz	Structural Basis of Ribosomal S6 Kinase 1 (RSK1) Inhibition by S100B Protein: MODULATION OF THE EXTRACELLULAR SIGNAL-REGULATED KINASE (ERK) SIGNALING CASCADE IN A CALCIUM-DEPENDENT WAY.
19	PDB:7q83D	0.156	0.113	6.822	156	0.065	0.045	7q83D.pdb.gz
20	PDB:7ajtUO	0.174	0.060	7.274	493	0.065	0.014	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9HCU8	5.71e-75	218	107	1.000	1.000	DPOD4_HUMAN DNA polymerase delta subunit 4 OS=Homo sapiens OX=9606 GN=POLD4 PE=1 SV=1
2	Q3T0X9	2.83e-63	189	107	0.860	0.860	DPOD4_BOVIN DNA polymerase delta subunit 4 OS=Bos taurus OX=9913 GN=POLD4 PE=1 SV=1
3	Q6P6U6	1.13e-61	185	107	0.832	0.832	Q6P6U6_RAT DNA polymerase delta 4, accessory subunit OS=Rattus norvegicus OX=10116 GN=Pold4 PE=4 SV=1
4	Q9CWP8	1.49e-61	184	107	0.832	0.832	DPOD4_MOUSE DNA polymerase delta subunit 4 OS=Mus musculus OX=10090 GN=Pold4 PE=1 SV=1
5	O59835	3.21e-08	50.4	160	0.196	0.131	DPOD4_SCHPO DNA polymerase delta subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdm1 PE=2 SV=1
6	P0A3W0	1.1	30.4	789	0.206	0.028	VIRB4_RHIRD Protein virB4 OS=Rhizobium radiobacter OX=358 GN=virB4 PE=1 SV=1
7	A8D8P8	2.8	29.3	899	0.271	0.032	SIWI_BOMMO Piwi-like protein Siwi OS=Bombyx mori OX=7091 GN=Siwi PE=1 SV=1
8	Q9HDX9	3.1	29.3	526	0.150	0.030	SYEM_SCHPO Glutamate--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mse1 PE=3 SV=1
9	Q8N5Z0	3.4	28.9	425	0.112	0.028	AADAT_HUMAN Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=AADAT PE=1 SV=2
10	O61827	4.9	28.5	655	0.159	0.026	O61827_CAEEL Cyclic nucleotide-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=che-6 PE=4 SV=3
11	Q9WVM8	6.6	28.1	425	0.121	0.031	AADAT_MOUSE Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Aadat PE=1 SV=1
12	Q61180	8.1	27.7	699	0.121	0.019	SCNNA_MOUSE Amiloride-sensitive sodium channel subunit alpha OS=Mus musculus OX=10090 GN=Scnn1a PE=1 SV=2
13	Q9V3D1	8.2	27.7	297	0.159	0.057	Q9V3D1_DROME glucose-6-phosphate 1-epimerase OS=Drosophila melanogaster OX=7227 GN=BG:DS00797.2 PE=1 SV=1
14	Q0DR28	8.3	27.7	518	0.121	0.025	PUB57_ORYSJ U-box domain-containing protein 57 OS=Oryza sativa subsp. japonica OX=39947 GN=PUB57 PE=2 SV=1
15	Q8IP67	8.8	27.7	289	0.159	0.059	Q8IP67_DROME glucose-6-phosphate 1-epimerase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9008 PE=1 SV=3
16	Q5BG07	9.3	27.7	2476	0.093	0.004	PKDA_EMENI Non-reducing polyketide synthase pkdA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkdA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04081 DNA_pol_delta_4	2.9e-15	68.2	DNA polymerase delta, subunit 4

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311368

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263681	0.999	DNA polymerase delta subunit 3
2	9606.ENSP00000406046	0.999	DNA polymerase delta catalytic subunit
3	9606.ENSP00000480186	0.997	DNA polymerase delta subunit 2
4	9606.ENSP00000368458	0.958	Proliferating cell nuclear antigen
5	9606.ENSP00000305480	0.936	Flap endonuclease 1
6	9606.ENSP00000278616	0.929	Serine-protein kinase ATM
7	9606.ENSP00000317039	0.917	RecQ-mediated genome instability protein 1
8	9606.ENSP00000442336	0.917	DNA topoisomerase 3-alpha
9	9606.ENSP00000355506	0.915	Exonuclease 1
10	9606.ENSP00000259008	0.904	Fanconi anemia group J protein
11	9606.ENSP00000310356	0.904	RecQ-mediated genome instability protein 2
12	9606.ENSP00000298139	0.903	Werner syndrome ATP-dependent helicase
13	9606.ENSP00000265433	0.901	Nibrin
14	9606.ENSP00000369497	0.901	Breast cancer type 2 susceptibility protein
15	9606.ENSP00000418960	0.901	Breast cancer type 1 susceptibility protein
16	9606.ENSP00000228843	0.900	RAD51-associated protein 1
17	9606.ENSP00000260947	0.900	BRCA1-associated RING domain protein 1
18	9606.ENSP00000261584	0.900	Partner and localizer of BRCA2
19	9606.ENSP00000262887	0.900	DNA repair protein XRCC1
20	9606.ENSP00000300035	0.900	PCNA-associated factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:1901360	0.998	organic cyclic compound metabolic process
GO:0043170	0.998	macromolecule metabolic process
GO:0046483	0.998	heterocycle metabolic process
GO:0006725	0.998	cellular aromatic compound metabolic process
GO:0034641	0.998	cellular nitrogen compound metabolic process
GO:0006260	0.983	DNA replication
GO:0006261	0.934	DNA-templated DNA replication
GO:0065007	0.572	biological regulation
GO:0050789	0.563	regulation of biological process
GO:0034654	0.550	nucleobase-containing compound biosynthetic process
GO:0009059	0.547	macromolecule biosynthetic process
GO:0050794	0.533	regulation of cellular process
GO:0071897	0.443	DNA biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005657	1.000	replication fork
GO:0140513	1.000	nuclear protein-containing complex
GO:0000228	1.000	nuclear chromosome
GO:0032993	0.999	protein-DNA complex
GO:0005654	0.997	nucleoplasm
GO:0042575	0.996	DNA polymerase complex
GO:0043601	0.988	nuclear replisome
GO:0043625	0.983	delta DNA polymerase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]